Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
City Council Agenda Packet 06-23-2014
AGENDA REGULAR MEETING – MONTICELLO CITY COUNCIL Monday, June 23, 2014 – 7 p.m. Mississippi Room, Monticello Community Center Mayor: Clint Herbst Council Members: Lloyd Hilgart, Tom Perrault, Glen Posusta, Brian Stumpf 1. Call to Order and Pledge of Allegiance 2A. Approval of Minutes – May 27, 2014 Regular Meeting 2B. Approval of Minutes – June 9, 2014 Special Meeting 2C. Approval of Minutes – June 9, 2014 Regular Meeting 3. Consideration of adding items to the agenda 4. Citizen comments, public service announcements, and updates A. Citizen Comments: B. Public Service Announcements: 1) Movie in the Park (6/28) 2) MCC Block Party (7/12) 3) Riverfest (7/11-13) 4) “The Legends in Purple” at Hi Way Liquors (7/12) 5) Xcel tree-trimming C. Updates: 1) Public transit service: Trailblazer Transit presentation on Monday, June 30th at 6 PM at St. Michael City Hall 5. Consent Agenda: A. Consideration of approving payment of bills for June 23rd B. Consideration of approving new hires and departures for City departments C. Consideration of a adopting Resolution #2014-063 establishing an Absentee Ballot Board for the 2014 Elections D. Consideration of appointing election judges to serve for the 2014 elections, including judges for the Absentee Ballot Board and Health Care Facility voting E. Consideration of approving individual pension contribution amount for Monticello Fire Relief Association members SPECIAL MEETING 6:15 p.m. - Budget Workshop F. Consideration of approving a Special Event Permit allowing use of city streets and related assistance for the Downtown Block Party on July 9, 2014. Applicant: Monticello Chamber/Cornerstone Cafe G. Consideration of approving Special Event Permit allowing use of Ellison Park and related assistance in conjunction with Art in the Park/Taste of Monticello on Saturday, July 12, 2014. Applicant: Monticello Chamber of Commerce H. Consideration of approving Special Event Permit allowing use of Ellison Park, West Bridge Park, Pioneer Park, and Community Center Parking Lot; use of city streets for the Riverfest parade; and related assistance in conjunction with the annual Riverfest celebration on July 12-13, 2014. Applicant: Riverfest Committee I. Consideration of approving a Special Event Permit for outdoor entertainment at Chatter’s Bar & Grill on July 11, 2014. Applicant: Richard Brendsel/West River Restaurants, Inc 6. Consideration of items removed from the consent agenda for discussion 7. Regular Agenda: A. Public Hearing - Consideration of approving the 2013 Storm Water Pollution Prevention Program (SWPPP) Annual Report B. Consideration of adopting Resolution #2014-064 approving a lease agreement with Verizon Wireless for a Wireless Telecommunications Monopole, City Project No. ZTOWER C. Consideration of adopting Resolution #2014-065 accepting bids and awarding contract(s) for a Wireless Telecommunications Monopole, City Project No. ZTOWER D. Consideration of Analysis related to Interim Ordinance #590, an interim ordinance allowing Places of Public Assembly on a temporary basis as a principal or accessory use in a B-3 Highway Business) District 8. Added items 9. Adjournment City Council Minutes – May 27, 2014 Page 1 MINUTES REGULAR MEETING – MONTICELLO CITY COUNCIL TUESDAY, May 27, 2014 – 7 p.m. Mississippi Room, Monticello Community Center Present: Clint Herbst, Lloyd Hilgart, Tom Perrault, Glen Posusta, Brian Stumpf Absent: None 1. Call to Order and Pledge of Allegiance Mayor Herbst called the meeting to order at 7 p.m. and declared a quorum present. The Pledge of Allegiance was recited. 2A. Approval of Minutes – May 12, 2014 Regular Meeting BRIAN STUMPF MOVED TO ACCEPT THE MINUTES FOR THE MAY 12, 2014 REGULAR MEETING AS PRESENTED. TOM PERRAULT SECONDED THE MOTION. MOTION CARRIED 5-0. 3. Consideration of adding items to the agenda Cargill clean-up: Jeff O’Neill thanked Cargill Kitchen Solutions employees for their efforts in community clean-up this spring. Transportation issues (Tom Perrault) 4. Citizen comments, public service announcements, and updates a. Citizen Comments: None b. Public Service Announcements: 1) Walk ‘n Roll (6/14) – Angela Schumann mentioned that Walk & Roll will take place on Saturday, June 14th from 9 a.m. to noon. The events start at the Hospital and go along East River Street ending at West Bridge Park. At 1 p.m. prize drawings will take place in the park for bikes and other items. Participants can get into the drawing by having their pathport stamped at booths along the Walk & Roll route. c. Updates: 1) Market Matching – John Uphoff from WSB provided an update to Council on activities that have been taking place. John Uphoff handed out some samples to Council which included market data reports since 2010. These reports are used by marketing people and developers when searching for community information. John Uphoff talked about the housing market analysis that he has been working on. John Uphoff also showed a 4-page handout, which they are using for marketing, which includes a focus on fiber technology as a unique feature of Monticello. John Uphoff noted City Council Minutes – May 27, 2014 Page 2 they are working on continuing to identify business properties which are for sale so those can be linked online. Lloyd Hilgart asked about the “shovel ready” page, and John Uphoff stated that is an example and can be replaced with a real property located in Monticello. Angela Schumann indicated that staff is still working with these documents and Council should identify any changes they might want to make. John Uphoff explained that they are working with two manufacturers that are considering locating in Monticello. They are also in discussion with a possible developer interested in the downtown area. WSB is in the process of contacting some national hotel chains to see if they could generate an interest in coming to check out Monticello as a possible site in the future. They are also in discussions with several national residential housing developers. 2) I-94 Construction Project – Shibani Bisson provided an update on the recent work on I-94. On Friday, there was a pavement failure which delayed the start of the reconstruction westbound lanes. Later in the week, the westbound traffic will be switched over to the temporary lanes. The exit ramp for westboundI-94 to Hwy 25 will be closed later this week until the end of July and traffic must use the CR18 exit into Monticello. Clint Herbst asked if there was appropriate signage on the freeway alerting travelers that they have to exit at CR 18 in order to get into Monticello. Shibani indicated that there are message boards and signage indicating it as the only exit to Monticello. Steve Grittman noted that there are several signs along I-94 warning drivers that there is only one exit. The westbound on-ramp from TH 25 will close next week for 30 days, resulting in a detour to Hasty via Broadway/CSAH 75. The westbound on- ramp from CR 18 is closed until October. The eastbound entrance ramps from TH 25 will remain closed until October. Shibani Bisson noted that MnDOT is continuing to monitor the signal systems around town and make adjustments as needed. 3) Department of Building Safety report (moved to June 9th meeting) 5. Consent Agenda: A. Consideration of approving payment of bills for May 27th. Recommendation: Approve payment of bill and purchase card registers for May 27th for a total amount of $610,865.94. B. Consideration of approving new hires and departures for City departments. Recommendation: Ratify new hired and terminations for Water, DMV, Parks, MCC, and Streets. City Council Minutes – May 27, 2014 Page 3 C. Consideration of adopting Resolution #2014-053 to accept a contribution from Uptown Eyecare for the Community Center Farmer’s Market. Recommendation: Adopt Resolution #2014-053 accepting contribution of $400 from Uptown Eyecare for the entertainment at the Community Center Farmers Market. D. Consideration of adopting Resolution #2014-054 to accept a contribution from TDS Telecom for the Community Center’s Visit with Santa program. Recommendation: Adopt Resolution #2014-054 accepting contribution of $400 from TDS Telecom for pictures for the Visit with Santa program. E. Consideration of rejecting all bids for the purchase of a new fire tender. Recommendation: Remove item from the table and reject all bids for the purchase of a new fire tender. A new proposal will be presented at an upcoming council meeting. F. Consideration of approving additional work for audit/conversion of FiberNet’s SourceOne billing system. THIS ITEM WAS REMOVED FROM THE CONSENT AGENDA. G. Consideration of approving a Letter of Agreement between the City of Monticello and Northern States Power Company-Minnesota for provision of emergency services. Recommendation: Approve the proposed Letter of Agreement between the City of Monticello and Northern States Power-Monticello for the provision of emergency services to the Monticello Nuclear Generating Plant. H. Consideration of adopting Resolutions #2014-055 accepting quotes and awarding contract for the 2014 Sealcoat and Fog Seal Project. THIS ITEM WAS REMOVED FROM THE CONSENT AGENDA. I. Consideration of approving an investment up to $2,500 in an application for $10,000 in matching funds for a Blandin Innovation Grant. THIS ITEM WAS REMOVED FROM THE CONSENT AGENDA. BRIAN STUMPF MOVED TO APPROVE THE CONSENT AGENDA WITH THE REMOVAL OF ITEMS F, H, AND I. LLOYD HILGART SECONDED THE MOTION. MOTION CARRIED 5-0. 6. Consideration of items removed from the consent agenda for discussion 5F. Consideration of approving additional work for audit/conversion of FiberNet’s SourceOne billing system Tom Perrault removed this item because he wanted an explanation of the additional expense with the billing system. Brian Estrem explained that staff did not have a chance to really look at what was included in the previous billing system and what reports might City Council Minutes – May 27, 2014 Page 4 be required for audit and regulatory compliance. The new billing system was converted in a very short time frame and bills are being sent out with no issues. However, there is a need to produce reports to audit what is being billed and verify that the system is in compliance with federal and state regulations. Glen Posusta asked if this would be a one- time charge and Brian Estrem confirmed this is correct. LLOYD HILGART MOVED TO APPROVE SEVERAL PROGRAMMING UPDATES FOR THE SOURCEONE BILLING SYSTEM AT A COST NOT TO EXCEED $5,000. TOM PERRAULT SECONDED THE MOTION. MOTION CARRIED 5-0. 5H. Consideration of adopting Resolutions #2014-055 accepting quotes and awarding contract for the 2014 Sealcoat and Fog Seal Project Tom Perrault asked about Marvin Elwood and other side roads, and why they are not being included in this project. Tom Moores explained that those two roads are beyond chip sealing so were not included. BRIAN STUMPF MOVED TO ADOPT RESOLUTION #2014-055 ACCEPTING BIDS AND AWARD A CONTRACT TO ALLIED BLACKTOP COMPANY OF MAPLE GROVE FOR THE COMBINED SEALCOATING AND FOG SEALING PROJECT AT A COST OF $113,752.02. LLOYD HILGART SECONDED THE MOTION. MOTION CARRIED 5-0. 5I. Consideration of approving an investment up to $2,500 in an application for $10,000 in matching funds for a Blandin Innovation Grant Jeff O’Neill asked to have this pulled so that Brian Estrem could talk about the purpose of this request. Brian Estrem explained that the Blandin Innovation Grant is one of many that the Blandin Foundation offers for various municipal and public projects. Brian Estrem talked about the purpose behind this grant, which is to explore the possibility of forming an alliance of municipalities and small telephone companies that currently provide broadband services in Minnesota communities. Such an alliance would have the potential to save money and create efficiencies by sharing resources, ideas, equipment, and technology expertise. The city is asking Council to approve a minimum match of up to $2500 for a $10,000 grant. Brian Estrem estimates that the study would probably total about $20,000 total, and he is hoping to have other communities contribute a matching share to raise the matching funds up to $10,000. There are several other communities that have indicated an interest in partnering on this so it is probable that each would only need to contribute $2,000 and he has a verbal commitment from two others so far. Brian Stumpf asked about the makeup of a board to direct an alliance of this type. Brian Estrem talked briefly about some of the people that would probably be involved in the study and potential board members that could serve as directors of such an alliance. The study would also include structure, purpose, and formation of an entity. Brian Stumpf also asked about the timeline for this study. Brian indicated that the award would happen City Council Minutes – May 27, 2014 Page 5 July 9th and should be completed before the end of the year. It is possible that there may be a chance for additional Blandin funding in 2015. BRIAN STUMPF MOVED TO APPROVE MATCHING FUNDS IN AN AMOUNT OF $2,000 FOR AN APPLICATION FOR A BLANDIN INNOVATION GRANT OF UP TO $10,000. LLOYD HILGART SECONDED THE MOTION. MOTION CARRIED 5-0. 7. Regular Agenda: A. Consideration of adopting Resolution #2014-057 approving the conditional use permit for cross-access, preliminary and final Plat, and development contract, and approving the Dundas Road easement agreement and encroachment agreement for the Cedar Street Addition (Goodwill), a commercial subdivision in a B-3 (Highway Business) and B-4 (Regional Business) District. Applicant: Oppidan Holdings, LLC Steve Grittman presented this item to Council pointing out that this development consists of a plat for the Cedar Street Addition with the remaining portion of the land to remain as an outlot of about 35 acres. In addition to the plat, the City would also receive an easement agreement for Dundas Road where it crosses the existing outlot. The conditional use permit for shared access is related to the undeveloped property to the north of the proposed Cedar Street Addition at such time as that property would be developed. The B-3 use proposed for the Cedar Street Addition is permitted in this district and the Planning Commission unanimously approved all items with a list of conditions and they recommend approval by Council. The developer has already met some of the conditions since the Planning Commission meeting. Glen Posusta asked about the proposed landscaping plan and how many trees are included in this development. Steve Grittman noted that staff did review this plan in respect to requirements in the ordinance and confirmed that it meets those requirements. Clint Herbst commented that he feels this is in keeping with preferences previously identified for business uses. Tom Perrault asked about a comment in the letter from WSB addressing the private watermain around the building. Steve Grittman explained that the looping of the watermain is not needed because the existing water pressure and fire flows are adequate. Steve noted the wording of that sentence inadvertently included the word “not” (in front of “adequate”) which changed the intent of the sentence. LLOYD HILGART MOVED FOR ALTERNATIVE #1 TO ADOPT RESOLUTION #2014-057 APPROVING THE CONDITIONAL USE PERMIT FOR CROSS-ACCESS, PRELIMINARY AND FINAL PLAT, AND DEVELOPMENT CONTRACT; AND APPROVING THE DUNDAS ROAD City Council Minutes – May 27, 2014 Page 6 EASEMENT AGREEMENT AND ENCROACHMENT AGREEMENT FOR THE CEDAR STREET ADDITION, BASED ON FINDINGS IN SAID RESOLUTION AND SUBJECT TO CONDITIONS IN EXHIBIT Z AS FOLLOWS. TOM PERRAULT SECONDED THE MOTION. MOTION CARRIED 5-0. The final plat must show required drainage and utility easements around the perimeter of the parcel and such easements shall be dedicated to the city. The final plat shall include the platting of the full right-of-way for Cedar Street. The final plat shall include an easement through Outlot A for Dundas Road. The proposed utility, grading, drainage, and erosion control plans are subject to review and comment by the City Engineer. The applicant shall comply with all recommendations of the City Engineer as provided in the comment letter dated May 1st, 2014. The applicant shall execute a development agreement covering the terms of the City’s Plat and CUP approval. A sidewalk connection must be installed between the northeast drive access and north property line. A trail connection must be provided from the parking lot to the trail along TH 25. Additional landscaping must be provided at the southeast corner of the property to ensure sufficient screening of the loading area. All landscaped areas must be irrigated. The applicant must obtain approval from easement holders for all proposed tree and shrub plantings in easement areas. The northeast driveway must be realigned per engineer’s requirements; if parking spaces are removed as a result, a proof of parking area should be designated on the site. Encroachment agreements must be filed with the city for all areas where drive aisles encroach on drainage and utility easements. Future curb cut access locations between the parcel in question and the adjoining property to the north shall be subject to review and approval by the city. Developer shall enter into a shared access and maintenance agreement with the adjoining property owner to the north to be recorded against both parcels if at such time the parcel to the north is developed and requires two access points from Cedar Street, unless alternative access plans are otherwise approved by the City. B. Consideration of adopting Ordinance #596 amending Title 10 of the Monticello Zoning Ordinance, Chapter 2.4(P) – Specific Review Requirements, Planned Unit Developments and Section 2.3 (I) relating to written notification for Planned Unit Development applications; and adopting Summary Ordinance #596A for publication Steve Grittman explained that this item consists of some general updates to the PUD zoning requirements. Staff has been tracking issues and concerns that have come up with some of the PUD processes, in particular the timeline allowed for requests. The City Attorney has expressed his concern about the timeline that the City Council Minutes – May 27, 2014 Page 7 City has been using and has recommended streamlining the process and reducing the number of days before final stage PUD. The concept stage would be preliminary and would not require an application, only a review with Planning Commission and Council, with no formal decision. If that step is satisfactory, the applicant could then file an application for a PUD and begin the formal process. Tom Perrault asked Steve Grittman to comment on the section titled “PUD Amendments” regarding the percentages for residential dwelling units. Steve Grittman said the percentage is essentially a marker at which time a PUD amendment would be required. Tom Perrault also asked about the section “PUD Cancellation” and the vote that would be required to cancel. Steve Grittman explained that would be a simple majority vote which is the same needed for approval. Steve Grittman noted a cancellation might take place if a PUD was approved but never actually materialized. LLOYD HILGART MOVED FOR ALTERNATIVE #1 ADOPTING ORDINANCE NO. 596 AMENDING TITLE 10, MONTICELLO ZONING ORDINANCE, CHAPTER 2.5(P) – SPECIFIC REVIEW REQUIREMENTS FOR PLANNED UNIT DEVELOPMENTS AND SECTION 2.3(I) RELATING TO WRITTEN NOTIFICATION FOR PLANNED UNIT DEVELOPMENT APPLICATIONS; AND ADOPTING SUMMARY ORDINANCE #596A FOR PUBLICATION. TOM PERRAULT SECONDED THE MOTION. MOTION CARRIED 5-0. C. Consideration of adopting Resolution #2014-056 approving a PUD adjustment for the Swan River PUD and amendment to Development Contract for the Swan River PUD. Applicant. Miller, Eric/SRCS Building Company, o/b/o Swan River Montessori Angela Schumann explained that Council had approved the Swan River PUD on April 28, 2014 with a shift to the crosswalk from mid-block to the corner intersection. As a result, Swan River Building Committee is requesting permission to remove the bump-out on the west side of Maple Street that they were intending on constructing along with their new building. Angela noted the required signage would also change if the bump-out is removed. Angela Schumann itemized the other changes that would be approved with the Swan River PUD adjustment and noted that these requirements have been added to the Development Contract. Glen Posusta asked what had happened on the loan proposed by Swan River. Jeff O’Neill explained that the City Attorney had found that cities cannot provide a loan of this type so the City is not proceeding with that request. Eric Miller of Swan River was apprised of this and they are looking for alternatives. Tom Perrault inquired on condition #8 which has not been met; Angela Schumann concurred and said that a grading permit would not be issued until all conditions City Council Minutes – May 27, 2014 Page 8 are satisfied. Tom also noted a correction to wording in the resolution to be adopted. LLOYD HILGART MOVED FOR ALTERNATIVE #1 TO ADOPT RESOLUTION #2014-056 APPROVING THE PUD ADJUSTMENT AND AMENDMENT TO THE DEVELOPMENT CONTRACT FOR THE SWAN RIVER PUD; SAID REVISIONS TO REMOVE THE PROPOSED BUMP OUT FOR MAPLE STREET AND FOR CORRESPONDING LOADING/PARKING SIGNAGE. BRIAN STUMPF SECONDED THE MOTION. MOTION CARRIED 5-0. D. Consideration of approving the concept of entering into a Joint Powers Agreement for public transit service in Monticello and other Wright County cities Clint Herbst expressed some of his concerns with the process that MnDOT is promoting to replace River Rider with another transit provider. Jeff O’Neill indicated that he just received an email from Gary Ludwig of Trailblazer Transit offering to meet with any city officials to answer questions. Clint Herbst commented that Monticello has been involved with transit for many years and probably has one of the longest running systems in Wright County. Clint Herbst requested that the City have a chance to provide input if and when Trailblazer comes to talk to city officials. Clint Herbst indicated he would like that meeting to take place before the next Council meeting if possible. TOM PERRAULT MOVED FOR ALTERNATIVE #3 TO TABLE ACTION ON A JOINT POWERS AGREEMENT INDEFINITELY. LLOYD HILGART SECONDED THE MOTION. MOTION CARRIED 5-0. 8. Added items Transportation Issues – Tom Perrault has been contacted by persons living along West 7th Street who have been stopped by travelers looking for directions to get back on I-94. He asked if there is a possibility of getting some signage in that area. Tom Perrault has also had some inquiries about doing a traffic speed study on School Boulevard. Shibani Bisson stated that usually requires a resolution by Council to make a request that MnDOT perform such a speed study and noted a speed study was conducted within the last five years or so. MnDOT will determine what the speed should be based on what 85% of the people are traveling and other criteria, such as grade, sight lines, etc. The resulting speed could go higher or lower than what is currently posted. Clint Herbst commented on the speed limit on 7th Street as it varies between 30mph and 35 mph and is confusing. Shibani Bisson will take a look at the speed limit signs along 7th Street to address consistency. City Council Minutes – May 27, 2014 Page 9 9. Adjournment TOM PERRAULT MOVED TO ADJOURN THE MEETING AT 8:28 P.M. LLOYD HILGART SECONDED THE MOTION. MOTION CARRIED 5-0. Recorder: Catherine M. Shuman ____ Approved: Attest: _________________________ City Administrator City Council Special Meeting Minutes – June 9, 2014 Page 1 MINUTES SPECIAL MEETING – MONTICELLO CITY COUNCIL Monday, June 9, 2014 – 6:00 p.m. Mississippi Room, Monticello Community Center Present: Clint Herbst, Lloyd Hilgart, Tom Perrault, Glen Posusta, Brian Stumpf Absent: None Others: Jeff O’Neill, Wayne Oberg, Sheriff Joe Hagerty (Wright County Sheriff’s Department), Dave Anderson (WCSD), Todd Sandin (WCSD), Dan Anselment (WCSD), Jason Roubinek (Police Advisory Commission), Brad Fyle (PAC) 1. Call to Order The special meeting was called to order by Mayor Herbst at 6:01 p.m. 2. Purpose of Meeting: Discussion of law enforcement service hours with Wright County and possible contract adjustment for 2015 Jeff O’Neill led off the discussion with a statement of the purpose of the meeting and asked for an introduction from those present. He then turned the meeting over to Wright County Sheriff Joe Hagerty. 3. Review 2014 service demand trends and discuss police patrol hours for 2015 Sheriff Hagerty explained that he had requested a meeting with the City Council to discuss the hours of service for law enforcement. He noted that Council had reduced the contract by four hours per day for 2014. Since that time, requests for some services have been increasing, and they would like the City to consider reinstating those hours for 2015. Dan Anselment took over and reviewed the 1st quarter hours of service and service calls. He talked about the impact of the reduction in service hours using an example of problems that occurred earlier this year at the community center and the delay in getting there due to fewer cars on patrol during that time. Dan Anselment commented that Monticello has a lot going for it with traffic and business opportunities. However, this also increases the opportunities for crimes and other incidents. Several examples he mentioned involved organized crime sprees of shoplifting and theft, including theft of credit cards. These type of calls take longer for an officer to process and try to resolve. Clint Herbst asked if the Sheriff’s Department has a process for backfilling with other officers when there are a lot of things going on at the same time. Dan Anselment and Dave Anderson explained how they call in other cars to backup when the need exists. Dan Anselment commented that a main concern at this time is traffic which increases during the summer season. This is particularly important in the Monticello area with City Council Special Meeting Minutes – June 9, 2014 Page 2 I-94 bisecting the City. There was some discussion about handling crashes and who is responsible. Dave Anderson explained that the state patrol handles crashes on the freeway, but the county is responsible for traffic control off the freeway. Dan Anselment noted that travelers are taking a lot of side streets with the I-94 detour and that is creating more activity for the county cars. Dan Anselment also mentioned that people like to see squad cars in their neighborhoods to know that they are being protected. Wright County Sheriff’s Department wants to make sure that they are not just responding to calls but are being proactive for the City residents. Dan Anselment asked for questions and noted that he provided a handout to Council showing the cost of law enforcement services. The County is proposing a cost increase of $2 per hour for 2015. Dan Anselment noted that the main cost increases are created by staffing and fuel. Clint Herbst asked about the type of service calls and noted a drastic drop in alarm and fire calls. Jason Roubinek stated that the Fire Department has been working with businesses to improve their alarm systems so as not to have as many false alarms. Dave Anderson stated that he wasn’t sure that the number of alarms calls as listed is accurate. Dan Anselment noted that they will be implementing a new crime tracking system which should provide more accurate statistics. Jeff O’Neill asked Dan Anselment to comment on what they are seeing as causes for the increase in calls. Dan Anselment said that new growth, such as with new businesses, generates more calls. They like to bring in officers that can help solve criminal incidents and would use the extra four hours to bring in a car to concentrate on those type of calls. Todd Sandin noted that the types of crimes occurring at some of the local businesses are solvable crimes due to the better technology in place. The Sheriff’s Department would prefer to be available on a regular basis to help resolve those crimes. Dave Anderson explained some of the processes that they go through to work on a crime report, noting that each item could require an incident report. Brad Fyle noted that the Police Advisory Commission has discussed this several times and would like to see the City reinstate the four hours that were decreased for 2014. Glen Posusta said that he doesn’t see the necessity for increasing the hours again as he sees a lot of police coverage already present in Monticello. Dave Anderson pointed out that there are deputies that keep their squad cars in Monticello and travel through town to get to their areas. There are also area cars that pass through town on a regular basis. Clint Herbst noted that the Council will discuss this at a council meeting in the near future so they can notify the County in advance of the August 15th deadline whether there would be any changes. Lloyd Hilgart asked what type of crimes they are seeing more. Dan Anselment said many of them are technology-related: cell phones, credit/debit cards, computers, etc. Wayne Oberg asked about the rate of crimes that are solved. Dan Anselment noted City Council Special Meeting Minutes – June 9, 2014 Page 3 that more crimes are being solved but it takes more time and involves more specialized law enforcement. Dave Anderson talked about the type of crimes and expects more violent type of crimes to increase, especially with the traffic coming in from out of town. Wright County is seeing a lot of drugs come through with meth and heroin increasing along with prescription drugs. Wright County Sheriff’s Department provides a take back program for prescription medicines at the law enforcement center in Buffalo. They could look into holding a collection day in Monticello. 4. Adjournment TOM PERRAULT MOVED TO ADJOURN THE SPECIAL MEETING AT 6:48 P.M. GLEN POSUSTA SECONDED THE MOTION. MOTION CARRIED 5-0. Recorder: Catherine M. Shuman ____ Approved: Attest: ______________________________ City Administrator City Council Minutes – June 9, 2014 Page 1 MINUTES REGULAR MEETING – MONTICELLO CITY COUNCIL Monday, June 9, 2014 – 7 p.m. Mississippi Room, Monticello Community Center Present: Clint Herbst, Lloyd Hilgart, Tom Perrault, Glen Posusta, Brian Stumpf Absent: None 1. Call to Order and Pledge of Allegiance Mayor Herbst called the meeting to order at 7 p.m. and declared a quorum present. The Pledge of Allegiance was recited. 2A. Approval of Minutes – May 27, 2014 Regular Meeting (to be approved on June 23rd) 3. Consideration of adding items to the agenda Blight Notices (Glen Posusta) Transit update (Jeff O’Neill) Signs (Glen Posusta) 4. Citizen comments, public service announcements, and updates A. Citizen Comments: 1) CenterPoint Energy grant presentation - Sherry Kemmetmueller, from CenterPoint Energy, talked about the grant program that is offered within the communities served by CenterPoint Energy. They support grants for safety equipment such as the gas monitors for the Fire Department and AED units for the community center. Since 2003, the program has exceeded $1.2 million in donations and provided funding for 632 projects in communities in their service area. The grant for the City of Monticello totaled $2,500. B. Public Service Announcements: 1) Walk & Roll (6/14) – Angela Schumann provided information about Walk & Roll taking place this Saturday, June 14th starting at the Hospital, following River Street, and ending at West Bridge Park. There are over 70 local businesses and organizations that will have booths along the route. 28 bicycles will be given away with door prize drawings. Activities in West Bridge Park include concessions, KRWC Road Show, kiddie train rides, a jumping castle, and Riverfest duck adoptions. 2) Cedar Street Help Center Garden – Angela Schumann announced the garden will be planted this Saturday, June 14th at 10 a.m. at the Help Center site. Volunteers should bring gloves, gardening tools, and seeds or plants. City Council Minutes – June 9, 2014 Page 2 C. Updates: 1) Department of Building Safety report – Ron Hackenmueller, Building Safety Official provided a presentation for Council on activities in the building department. He discussed the responsibilities of the building department. The rental ordinance and licensing, in place since 2007, is handled by the city building staff. There are approximately 450 rental licenses that will be processed this year, and they conduct about 300 inspections each year. Blight inspections are also performed by the building department. Ron Hackenmueller noted that the number of properties being mowed has decreased since 2011. All building permits go through the building department. Ron Hackenmueller reviewed the change in building valuations from 2010 to 2014 broken out by type of permit. Right now about 43 permits have been issued for single family homes with a value of over $7 million. About 330 total building permits have been issued year to date, which includes all type of permits. The total valuation of permits issued has started to increase again. Permit revenues have varied over the years, which depends upon the type of permits that are issued. Over $320,000 is anticipated in building revenues including building permits and rental licensing. Ron Hackenmueller talked about help desk inquiries and the types of calls that they respond to. He also noted that he is responsible for REP (Radiological Emergency Preparedness) for the City. The REP program is related to the nuclear plant located in Monticello and involves many entities in the county. Ron Hackenmueller noted that the building department has been very busy so far this year with the influx of building permits and seasonal nuisance calls and inspections. 2) “Worth the Stop” promotion - Rachel Leonard gave an update to Council on the local Hwy 25 businesses and their efforts to increase visibility during the I-94 construction. Rachel has been attending their meetings and reviewed recent activity. The group is producing brochures about the businesses, which will include promotions and be made available in the businesses. They have also invested in a billboard located near the outlet mall in Albertville noting that Monticello is “worth the stop.” Clint Herbst also noted the concern of the businesses in getting traffic to leave the freeway at Monticello. He felt it would be helpful for the City to provide a contribution to the group. GLEN POSUSTA MOVED TO DONATE $1000 TO THE “WORTH THE STOP” GROUP TO HELP WITH THE PROMOTION ON BEHALF OF THE LIQUOR STORE AND COMMUNITY CENTER. BRIAN STUMPF SECONDED THE MOTION. MOTION CARRIED 5- 0. 5. Consent Agenda: City Council Minutes – June 9, 2014 Page 3 A. Consideration of approving payment of bills for June 9th. Recommendation: Approve the bill and purchase card registers for a total amount of $558,210.28. B. Consideration of approving new hires and departures for City departments. Recommendation: Ratify new hires and terminations for Liquor Store, MCC, Finance, and Parks. C. Consideration of adopting Resolution #2014-061 to accept an in-kind contribution from the Monticello Times/ECM Publishers, Inc. for sponsorship of Movie in the Park. Recommendation: Adopt Resolution #2014-061 to accept an in-kind contribution of advertising from the Monticello Times valued at $500 for sponsorship of Movie in the Park. D. Consideration of approving application for a 1-day temporary on-sale liquor license for the Monticello Rotary Club for Taste of the Town event. Recommendation: Approve application for a 1-day temporary on-sale liquor license for the Rotary Club’s Taste of the Town event on September 11, 2014. E. Consideration of approving a Special Event Permit allowing use of commuter parking lot and related assistance in conjunction with Rotary “Taste of the Town” event on September 11, 2014. Applicant: Monticello Rotary Club. Recommendation: Approve a Special Event Permit for the Monticello Rotary Club allowing use of commuter parking lot and related city staff assistance in conjunction with the Rotary Taste of the Town event, contingent on the following conditions: a. Continued site plan coordination with the Street Superintendent, including park and ride lot closure request verification b. Coordination of tent placement with engineering department relative to powerlines c. Submission of certificate of liability coverage with City named as additional insured d. Commuter lot closure signage and notification in coordination with the Street Superintendent F. Consideration of approving a Conditional Use Permit for Schools, K-12 (ISD 882 Alternative Learning Program) in an IBC (Industrial and Business Campus) District for Lots 6, 7, and 8, Block 2, Lauring Hillside Terrace (406 E 7th Street). Applicant: Colosimo, Mike/Monticello Training Center, LLC. Recommendation: Approve the conditional use permit to allow a school (Monticello School District Alternative Learning Program) in an IBC, Industrial and Business Campus District based on findings in Planning Commission Resolution #2014-058 and subject to conditions in Exhibit Z as follows: Bus circulation and related drop-off/pick-up activities shall be addressed to the satisfaction of the City. City Council Minutes – June 9, 2014 Page 4 Any new site signage shall comply with the applicable provisions of the sign ordinance and be subject to sign permit. G. Consideration of adopting Ordinance #599 approving miscellaneous amendments to Title 10 – Monticello Zoning Code and adopting Summary Ordinance #599A for publication. Applicant: City of Monticello. THIS ITEM WAS REMOVED FROM THE CONSENT AGENDA. H. Consideration of accepting amended sales proposal for purchase of a fire tender. Recommendation: Accept amended sales proposal for the purchase of a new fire tender from CustomFire for $333,524.10. GLEN POSUSTA MOVED TO APPROVE THE CONSENT AGENDA WITH THE REMOVAL OF ITEM G. BRIAN STUMPF SECONDED THE MOTION. MOTION CARRIED 5-0. 6. Consideration of items removed from the consent agenda for discussion 5G. Consideration of adopting Ordinance #599 approving miscellaneous amendments to Title 10 – Monticello Zoning Code and adopting Summary Ordinance #599A for publication. Applicant: City of Monticello Clint Herbst pulled this item to ask about the requirement for a garage in an R-2 district at only 450 SF. He feels this is quite small. Angela Schumann indicated this could be changed by Council, although they would need to amend the proposed ordinance in two places. Glen Posusta felt that an R-2 district should require a larger garage or same size as the R-1 district because of the denser residence and probable need for more garage space. Clint suggested they leave the ordinance adjustments as proposed and have this discussed further by Planning Commission. Angela Schumann also noted the summary ordinance would require a 4/5th vote for approval. LLOYD HILGART MOVED TO ADOPT ORDINANCE NO. 599 APPROVING MISCELLANEOUS AMENDMENTS TO THE MONTICELLO ZONING CODE SECTIONS AS FOLLOWS, AND ADOPT SUMMARY ORDINANCE NO. 599A FOR PUBLICATION. GLEN POSUSTA SECONDED THE MOTION. MOTION CARRIED 5-0. 2.3(G): Pre-Application Conferences 2.4(D): Conditional Use Permits 2.4(G): Administrative Adjustments 3.3(D)(2): Allowable Yard Encroachments 3.4(F): R-2 Single and Two-Family Residence District 4.3(C): General Requirements for Fences and Walls 4.3(G): Prohibited Fences 4.5(H): General Provisions (Signs) City Council Minutes – June 9, 2014 Page 5 4.5(J): District Regulations (Signs) 4.8(F)(2)(c): Residential District Garage Requirements 4.11(C): Residential District Requirements (R-1 District) 5.1: Use Table (Table 5-1: Uses by District) 8.4: Definitions 7. Regular Agenda: A. Consideration of approving an amendment to Conditional Use Permit for Planned Unit Development for an outdoor storage accessory use for Lot 1, Block 2, AMAX Addition (36 Dundas Road). Applicant: AMAX Self Storage Steve Grittman summarized this item for an amendment to CUP for PUD for outdoor storage accessory use for AMAX Self Storage. Steve Grittman described the proposed placement of temporary storage units and noted that would require a CUP amendment. Some grading will be done to the property to accommodate a retaining wall. The temporary storage units would be located immediately adjacent to the retaining wall. The existing code does have setback requirements; however, these are not permanent structures so it is felt that a zero setback could be considered. An encroachment agreement would be required either way. Steve Grittman review the zoning ordinance in respect to outdoor storage requirements. Steve Grittman noted the Planning Commission recommends an interim use permit under PUD for a period of five years. The original staff recommendation was for a period of ten years. Basically, the decision for Council involves consideration of the length of the term for the use and setback requirements. There was some discussion by Council about a zero setback versus a 6-ft setback. Brian Stumpf questioned whether any landscaping is required. Lloyd Hilgart brought up the guidelines for accessory outdoor storage which would require screening; Steve Grittman explained that screening would normally be required but is flexed with the PUD. Brian Stumpf questioned if the screening would be required when the land to the south is developed. Steve Grittman indicated that would be dependent on the nature of the development to the south. The term of five years versus ten years was discussed and consensus was that either could work. Tom Perrault stated he would prefer five years for the interim use. Brian Stumpf indicated that he was fine with ten years noting that Glen Posusta has been conducting business for many years and doesn’t anticipate any significant changes in the next ten years. BRIAN STUMPF MOVED FOR ALTERNATIVE #2 APPROVING AN AMENDMENT TO CONDITIONAL USE PERMIT FOR THE AMAX STORAGE PLANNED UNIT DEVELOPMENT BASED ON FINDINGS IN PLANNING COMMISSION RESOLUTION #2014-060, AND SUBJECT TO CONDITIONS IN EXHIBIT Z, WITH MODIFICATIONS (A) AND (B) AS FOLLOWS. LLOYD HILGART SECONDED THE MOTION. MOTION City Council Minutes – June 9, 2014 Page 6 CARRIED 3-1 TOM PERRAULT VOTING IN OPPOSITION. Glen Posusta abstained as he owns this property. (A) Consistency with staff recommendation for a 10-year interim use under PUD. (B) Removal of the condition relating to 6-ft setback, as the units are considered accessory outdoor storage, which may be directly adjacent to the property line. EXHIBIT Z The amendment shall be treated as an interim use under the existing planned unit development for a period not to exceed ten (10) years, after which the site will require a new amendment, and be returned to a condition in compliance with all applicable zoning regulations in effect at that time. Planning Commission recommends a period of five (5) years for the interim use under planned unit development. The applicant shall mark and submit drainage and stormwater plans identifying catch basin elevations and drainage patterns, in accordance with the requirements of the City Engineer. If the area designated for temporary storage units is vacant for a period of at least twelve months, the amendment shall expire, and the property be returned to a surface in accordance with zoning regulations. No active business or other occupancy may be made of the temporary storage buildings, with the exception of storage, and loading or unloading of said storage. The applicant shall verify the type and material of the current surfacing for the outdoor storage area. The material shall be sufficient to control dust. During the Planning Commission meeting, the applicant verified that the surface would be gravel sufficient to control dust. The applicant shall enter into an encroachment agreement as related to the retaining wall and placement of outdoor storage within the existing southern drainage and utility easement. The proposed storage units shall remain 6’ from the property line. For outdoor storage accessory use, no setback would be required. Council may wish to modify this condition accordingly. An encroachment agreement would still be required. The applicant shall enter into a development agreement with the City specifying the terms of the PUD, including the termination date as agreed to by the City Council. B. Consideration of adopting Resolution #2014-062 approving an amendment to the Monticello Comprehensive Plan to reguide land use from “Places to Shop” to “Places to Live” for Outlot A, Monticello Commerce Center 7th Addition (PID 155196000010). Applicant: City of Monticello Steve Grittman presented this item with a review of the subject property and request for a comp plan amendment for land use designation as “Places to Live.” The current zoning designation is B-4 (Regional Business District) and the intention would be to request rezoning to an R-4 (High Density Residence City Council Minutes – June 9, 2014 Page 7 District). There is a developer interested in the property and would be looking at constructing an apartment complex. Steve Grittman described the land and surrounding areas. He noted that there is a small piece of property that is currently designated as “Places to Shop” and located southeast of the subject property, which may need to be addressed in the future. Steve Grittman noted the proposed land use as “Places to Live” should create less of an impact on the natural environment and surrounding transportation corridors. The proposal is consistent with the guiding principles of the comp plan and this particular piece of land was identified previously by Council as a potential area for R-4 housing. Tom Perrault asked if that area has sufficient infrastructure to handle sewer and water needs. Steve Gritttman stated that he understands the area has sufficient capacity and residential sites usually have lower impacts on those type of utilities. GLEN POSUSTA MOVED FOR ALTERNATIVE #1 TO ADOPT RESOLUTION #2014-062 APPROVING AN AMENDMENT TO THE MONTICELLO COMPREHENSIVE PLAN TO REGUIDE OUTLOT A, MONTICELLO COMMERCE CENTER SEVENTH ADDITION FROM “PLACES TO SHOP” (COMMERCIAL) TO “PLACES TO LIVE” (RESIDENTIAL). BRIAN STUMPF SECONDED THE MOTION. MOTION CARRIED 5-0. 8. Added items Blight Notices – Glen Posusta suggested that the city consider revising the process for notification of blight notices, especially for vacant lots. Since many of those lots are owned by people that do not live in Monticello, he feels that they should only need one notice for the season and that the city would have the right to mow anytime that the grass exceeds the designated length or if other blight exists. Glen Posusta suggested that the city code be amended. Jeff O’Neill explained that this should be reviewed by the city’s legal representative to make sure we are able to do this. Jeff O’Neill also indicated that these changes may require more time and effort by city staff compared to the present system. Signs that need attention – Glen Posusta pointed out that there are a number of street signs which are fading and may need attention, in particular those along West River Street which were put up at the time of the 2010 Street Reconstruction project. He suggested checking on the warranty to determine if they would be covered under that. Brian Stumpf also noted that the signs in the fire department parking lot are also faded and should be replaced. Transit update – Jeff O’Neill updated Council on the current status of the provision of public transit services for Wright County. He noted that Trailblazer is concerned about being ready to provide service in Monticello when River Rider service ends on June 30th. They do not have enough buses and drivers currently. City staff and Mayor Herbst met with Hoglund Transportation, Gary Ludwig from City Council Minutes – June 9, 2014 Page 8 Trailblazer Transit, and Tom Gottfried from MnDOT to discuss some potential options to provide transit services for Monticello residents. Jeff O’Neill pointed out that some of the Wright County cities have signed on to a joint powers agreement to plan for public transit for their cities. Potentially they could serve as an authority for public transit in the county. Brian Stumpf asked if Trailblazer Transit is basically the only option to provide transit services. Jeff O’Neill commented that Tom Gottfried indicated that the City of Monticello will receive transit services in some manner and MnDOT has asked Trailblazer to be the provider. Jeff O’Neill added that there should be buses in the county and possibly in the vicinity of Monticello but not necessarily on a regular route in the City. Clint Herbst noted that Gary Ludwig of Trailblazer is supposed to meet with Hoglund Transportation to discuss the possibility of providing temporary bus service. Lloyd Hilgart asked if it would be in the best interest to provide as much service as needed in Monticello to generate revenues to help support the system. Jeff O’Neill explained that the cities involved in the joint powers agreement are supposed to be discussing the objectives and laying out a program for transit services. 9. Adjournment GLEN POSUSTA MOVED TO ADJOURN THE MEETING AT 8:16 P.M. BRIAN STUMPF SECONDED THE MOTION. MOTION CARRIED 5-0. Recorder: Catherine M. Shuman ____ Approved: Attest: _________________________ City Administrator CityCouncilAgenda:6/23/14 1 5A.ConsiderationofapprovingpaymentofbillsforJune23rd (WO) A.REFERENCEANDBACKGROUND: Citystaffsubmitstheattachedbillregistersandpurchasingcardregistersforapprovalby Council.Thebillregisterscontainallinvoicesprocessedandthepurchasingcard registerscontainallcardpurchasesmadesincethelastCouncilmeeting.SubjecttoMN Statutes,mostinvoicesrequireCouncilapprovalpriortoreleasingchecksforpayment. ThedayfollowingCouncilapproval,paymentswillbereleasedunlessdirected otherwise.AcreditpurchasingagreementandpolicywasapprovedbyCouncilinitially andcardpurchasesmustcomplywiththepolicy. IfCouncilhasnoquestionsorcommentsonthebillandpurchasecardregisters,thesecan beapprovedwiththeconsentagenda.Ifrequested,thisitemcanberemovedfrom consentanddiscussedpriortomakingamotionforapproval. A1.BudgetImpact:None A2.StaffWorkloadImpact:Noadditionalworkrequired B.ALTERNATIVEACTIONS: 1.Motiontoapprovethebillandpurchasecardregistersforatotalamountof $686,211.74. 2.MotiontoapprovetheregisterswithchangesdirectedbyCouncil. C.STAFFRECOMMENDATION: CitystaffrecommendsAlternative#1or#2,perdirectionofCouncil. D.SUPPORTINGDATA: Billregisters PurchaseCardregisters User: Printed:06/13/2014 - 10:49AM Ann.Zimmerman Computer Check Proof List by Vendor Accounts Payable Batch:00208.06.2014 - 00208.06.2014 AP Invoice No Description Amount Payment Date Acct Number Reference Vendor:3680 BRIAN ESTREM Check Sequence: 1 ACH Enabled: False 4 June 2014 management fee 11,500.00 06/13/2014 655-49870-430700 11,500.00Check Total: Total for Check Run: Total of Number of Checks: 11,500.00 1 AP-Computer Check Proof List by Vendor (06/13/2014 - 10:49 AM)Page 1 The preceding list of bills payable was reviewed and approved for payment. Date: 6/23/14 Approved by: ____________________________________ Mayor Clint Herbst User: Printed:06/18/2014 - 12:06PM Ann.Zimmerman Computer Check Proof List by Vendor Accounts Payable Batch:00206.06.2014 - 206.06.2014 AP Invoice No Description Amount Payment Date Acct Number Reference Vendor:1835 A H HERMEL COMPANY Check Sequence: 1 ACH Enabled: False 436639 re-sale 23.51 06/24/2014 226-45203-425410 23.51Check Total: Vendor:1021 AME RED E MIX INC Check Sequence: 2 ACH Enabled: False 49966 12C009 - (3.5) 6 bag; (3.5) buckeye fiber 1#; small load; ect. 630.00 06/24/2014 601-00000-165010 630.00Check Total: Vendor:1979 DONALD ANDERSON Check Sequence: 3 ACH Enabled: False 6/2/14 Reimb 6/2/14 Grady's - (3) keyblank 99 GM truck 8.97 06/24/2014 101-42200-421990 8.97Check Total: Vendor:1038 APPERTS FOOD SERVICE Check Sequence: 4 ACH Enabled: False 406060569 re-sale 406.70 06/24/2014 226-45203-425410 406060569 party room 206.96 06/24/2014 226-45127-421460 406060570 re-sale 176.60 06/24/2014 226-45203-425410 406060571 Friendship Island food supplies 396.29 06/24/2014 226-45127-421981 406060571 Friendship Island food supplies - freight 5.00 06/24/2014 226-45122-433300 406130568 party room supplies 78.61 06/24/2014 226-45127-421460 406130568 re-sale 456.53 06/24/2014 226-45127-425410 406130569 re-sale 214.51 06/24/2014 226-45203-425410 406130570 Walk N Roll 326.84 06/24/2014 226-45127-421980 406130571 Friendship Island 171.94 06/24/2014 226-45127-421981 406130571 freight 5.00 06/24/2014 226-45122-433300 2,444.98Check Total: Vendor:1040 ARAMARK UNIFORM SERVICES AUS MPLS MC LOCKBOX Check Sequence: 5 ACH Enabled: False 629-7985844 towel rental 38.55 06/24/2014 101-43127-421990 629-7985844 uniform rental 25.16 06/24/2014 101-45201-441700 629-7985844 uniform rental 11.47 06/24/2014 602-49490-441700 AP-Computer Check Proof List by Vendor (06/18/2014 - 12:06 PM)Page 1 Invoice No Description Amount Payment Date Acct Number Reference 629-7985844 uniform rental 11.47 06/24/2014 601-49440-441700 629-7985844 uniform rental 35.47 06/24/2014 101-43120-441700 629-7990499 uniform rental 25.01 06/24/2014 101-45201-441700 629-7990499 uniform rental 11.30 06/24/2014 602-49490-441700 629-7990499 uniform rental 11.30 06/24/2014 601-49440-441700 629-7990499 uniform rental 35.32 06/24/2014 101-43120-441700 629-7990499 towel rental 22.65 06/24/2014 101-43127-421990 629-7995103 towel rental 22.65 06/24/2014 101-43127-421990 629-7995103 uniform rental 25.01 06/24/2014 101-45201-441700 629-7995103 uniform rental 11.30 06/24/2014 602-49490-441700 629-7995103 uniform rental 11.30 06/24/2014 601-49440-441700 629-7995103 uniform rental 35.32 06/24/2014 101-43120-441700 629-7999828 uniform rental 25.01 06/24/2014 101-45201-441700 629-7999828 uniform rental 11.30 06/24/2014 602-49490-441700 629-7999828 uniform rental 11.30 06/24/2014 601-49440-441700 629-7999828 uniform rental 35.32 06/24/2014 101-43120-441700 629-7999828 towel rental 22.65 06/24/2014 101-43127-421990 438.86Check Total: Vendor:3491 ARTISAN BEER COMPANY Check Sequence: 6 ACH Enabled: False 54022 re-sale 153.75 06/24/2014 609-49750-425200 153.75Check Total: Vendor:3754 JEREMIAH BEAM Check Sequence: 7 ACH Enabled: False FNM Refund FNM-001-0060 15.78 06/24/2014 655-00000-115025 15.78Check Total: Vendor:1065 BELLBOY CORPORATION Check Sequence: 8 ACH Enabled: True 43324200 re sale 690.25 06/24/2014 609-49750-425100 43324200 freight 12.60 06/24/2014 609-49750-433300 43346700 re sale 527.50 06/24/2014 609-49750-425100 43346700 freight 9.00 06/24/2014 609-49750-433300 43430600 re-sale 1,215.46 06/24/2014 609-49750-425100 43430600 freight 14.85 06/24/2014 609-49750-433300 90287000 freight 1.07 06/24/2014 609-49750-433300 90287000 (1) 500 bag #12 x-hvy 60# 64.95 06/24/2014 609-49754-421990 90287000 re-sale 167.66 06/24/2014 609-49750-425400 90328300 freight 1.18 06/24/2014 609-49750-433300 90328300 re-sale 143.00 06/24/2014 609-49750-425400 90328300 (6) 500 sleeve assorted bags 114.40 06/24/2014 609-49754-421990 AP-Computer Check Proof List by Vendor (06/18/2014 - 12:06 PM)Page 2 Invoice No Description Amount Payment Date Acct Number Reference 2,961.92Check Total: Vendor:1067 BERNICK'S Check Sequence: 9 ACH Enabled: False 31117 re-sale 397.00 06/24/2014 226-45127-425410 31117 party room 12.80 06/24/2014 226-45127-421460 33622 re-sale 10.90 06/24/2014 609-49750-425500 33622 re-sale 52.80 06/24/2014 609-49750-425400 33623 re-sale 223.00 06/24/2014 609-49750-425200 33624 -20.00 06/24/2014 609-49750-425500 34377 party room 12.80 06/24/2014 226-45127-421460 34377 re-sale 371.00 06/24/2014 226-45127-425410 36742 re sale 32.80 06/24/2014 609-49750-425500 36742 re sale 127.60 06/24/2014 609-49750-425400 36743 re sale 1,153.55 06/24/2014 609-49750-425200 36744 re sale -10.80 06/24/2014 609-49750-425200 37395 re-sale 454.00 06/24/2014 226-45127-425410 2,817.45Check Total: Vendor:2576 BIG LAKE LUMBER Check Sequence: 10 ACH Enabled: False 20039169 ZZBCOL - (2) 2x6 10' above ground; (7) 2x6 8' above ground 72.12 06/24/2014 101-45201-421990 72.12Check Total: Vendor:2221 BIG TEN NETWORK LLC Check Sequence: 11 ACH Enabled: True H09019 Big 10 May 2014 1,400.82 06/24/2014 655-49860-430920 1,400.82Check Total: Vendor:2535 BORDER STATES ELECTRIC SUPPLY Check Sequence: 12 ACH Enabled: True 907472196 (5000) ft EXTT - 51-240-31 4PR/24CMX-CMR-CAT5E-GY-PP-I/O 705.38 06/24/2014 656-49877-421990 705.38Check Total: Vendor:1080 BRAEMAR MAILING SERVICE INC Check Sequence: 13 ACH Enabled: False 55367 UB Qtr 1 2014 delinquent (958) print; fold; insert; ect. (1/2) 73.32 06/24/2014 601-49440-431800 55367 UB Qtr 1 2014 delinquent (958) print; fold; insert; ect. (1/2) 73.32 06/24/2014 602-49490-431800 55367 UB Qtr 1 2014 delinquent (958) #10 envelope (1/2) 35.92 06/24/2014 602-49490-431800 55367 UB Qtr 1 2014 delinquent (958) #10 envelope (1/2) 35.93 06/24/2014 601-49440-431800 218.49Check Total: Vendor:2047 BRIDGE WATER TELEPHONE COMPANY Check Sequence: 14 ACH Enabled: True AP-Computer Check Proof List by Vendor (06/18/2014 - 12:06 PM)Page 3 Invoice No Description Amount Payment Date Acct Number Reference 665FNMT-S-14164 Voice - monthly access charges interstate 6/13-7/12/14 415.14 06/24/2014 655-49860-430910 415.14Check Total: Vendor:1095 CARLOS CREEK WINERY INC Check Sequence: 15 ACH Enabled: False 10346 re-sale 396.00 06/24/2014 609-49750-425300 396.00Check Total: Vendor:2220 CBS SPORTS NETWORK Check Sequence: 16 ACH Enabled: True 079610 CBS College Sports May 2014 59.15 06/24/2014 655-49860-430920 59.15Check Total: Vendor:2213 CBS TV STATIONS Check Sequence: 17 ACH Enabled: False May - 14 WCCO May 2014 829.00 06/24/2014 655-49860-430920 829.00Check Total: Vendor:1102 CENTERPOINT ENERGY Check Sequence: 18 ACH Enabled: False 5/30/14 8000014331-5 42.42 06/24/2014 217-41990-438300 5/30/14 8000014331-5 26.39 06/24/2014 101-45201-438300 5/30/14 8000014331-5 342.26 06/24/2014 101-42200-438300 5/30/14 8000014331-5 1,037.36 06/24/2014 101-43127-438300 6/11/14 5863599-6 28.34 06/24/2014 101-42700-438300 6/11/14 5804618-6 12.59 06/24/2014 101-45201-438300 6/2/14 5864452-7 176.21 06/24/2014 101-45501-438300 6/2/14 5788570-9 27.97 06/24/2014 609-49754-438300 6/2/14 5768542-2 179.67 06/24/2014 101-41940-438300 6/2/14 utx - 5768542-2 4,154.95 06/24/2014 226-45122-438300 6/2/14 5768542-2 67.38 06/24/2014 101-45175-438300 6/2/14 5768542-2 89.84 06/24/2014 101-42800-438300 6/2/14 5828859-8 14.62 06/24/2014 101-41940-438300 6/2/14 8235331-9 82.41 06/24/2014 101-41941-438300 6/2/14 8235333-5 20.71 06/24/2014 101-41941-438300 6/2/14 MGFARM - 9739641-0 19.39 06/24/2014 213-46522-438300 6/2/14 MGFARM - 9739645-1 12.60 06/24/2014 213-46522-438300 6/2/14 MGFARM - 9429449-3 13.27 06/24/2014 213-46522-438300 6/2/14 utx - MGFARM - 9429448-5 35.69 06/24/2014 213-46522-438300 6/2/14 utx - MGFARM - 9429450-1 64.03 06/24/2014 213-46522-438300 6,448.10Check Total: Vendor:1106 CENTRAL MCGOWAN INC Check Sequence: 19 ACH Enabled: False AP-Computer Check Proof List by Vendor (06/18/2014 - 12:06 PM)Page 4 Invoice No Description Amount Payment Date Acct Number Reference 00021344 Monthly facitily fee 48.09 06/24/2014 226-45122-441500 00790655 utx - delivergy charge 21.50 06/24/2014 226-45122-421600 00790655 (450) lb bulk carbon dioxide 101.00 06/24/2014 226-45122-421600 170.59Check Total: Vendor:2654 CENTURYLINK Check Sequence: 20 ACH Enabled: False R72010610614152 Voice - 6/1-6/30/14 monthly access charges - intrastate 600.00 06/24/2014 655-49860-430910 600.00Check Total: Vendor:2654 CENTURYLINK Check Sequence: 21 ACH Enabled: False R97006006014152 Voice - 6/1-6/30/14 monthly access charges - interstate; ect. 143.25 06/24/2014 655-49860-430910 143.25Check Total: Vendor:2654 CENTURYLINK Check Sequence: 22 ACH Enabled: False L04003703714152 Voice - usage billing cycle 6/1-6/30/14 132.41 06/24/2014 655-49860-430910 132.41Check Total: Vendor:2197 CORPORATE CONNECTION Check Sequence: 23 ACH Enabled: False 9670 Shipping for replacemt shirts (inv 9670 pd w/Visa) 6.58 06/24/2014 101-45201-420650 9670 Shipping for replacemt shirts (inv 9670 pd w/Visa) 6.58 06/24/2014 101-43120-420650 9670 Shipping for replacemt shirts (inv 9670 pd w/Visa) 6.58 06/24/2014 601-49440-420650 9670 Shipping for replacemt shirts (inv 9670 pd w/Visa) 6.58 06/24/2014 602-49490-420650 9732 (4) lime Class 2 T-shirt for seasonal park employee 67.17 06/24/2014 101-45201-420650 93.49Check Total: Vendor:2476 CSI DIGITAL INC Check Sequence: 24 ACH Enabled: True 102396 Trouble tickets - #2913 4/2714 NHL channel; #3077 6/6/14 GSN 140.00 06/24/2014 655-49870-432500 102397 10% balance Link set-up (see invoice 102303) 400.00 06/24/2014 655-49860-430930 102397 10% balance PDX to Mpls Gbps fiber feed (see invoice 102303) 270.00 06/24/2014 655-49860-430930 810.00Check Total: Vendor:1129 DAHLHEIMER BEVERAGE LLC Check Sequence: 25 ACH Enabled: True 1106880 re sale 21,594.30 06/24/2014 609-49750-425200 1106880 re sale 530.35 06/24/2014 609-49750-425400 1106939 re sale 13,512.31 06/24/2014 609-49750-425200 1106939 re sale 42.00 06/24/2014 609-49750-425400 92117 re-sale 267.00 06/24/2014 226-45203-425200 92177 re sale 1,025.65 06/24/2014 609-49750-425200 AP-Computer Check Proof List by Vendor (06/18/2014 - 12:06 PM)Page 5 Invoice No Description Amount Payment Date Acct Number Reference 92291 re-sale 297.00 06/24/2014 226-45203-425200 92450 re-sale 37.05 06/24/2014 609-49750-425200 92531 re sale 1,404.75 06/24/2014 609-49750-425200 92957 re sale -110.00 06/24/2014 609-49750-425200 92958 re sale 177.70 06/24/2014 609-49750-425200 38,778.11Check Total: Vendor:1133 DAVID'S PHOTOGRAPHY Check Sequence: 26 ACH Enabled: False 3264 (1) 8x10 portrait 75.00 06/24/2014 101-42200-421990 75.00Check Total: Vendor:1134 DAY DISTRIBUTING COMPANY Check Sequence: 27 ACH Enabled: True 755581 re sale 109.40 06/24/2014 609-49750-425400 755581 re sale 2,101.14 06/24/2014 609-49750-425200 2,210.54Check Total: Vendor:1136 GORDON J DEHMER Check Sequence: 28 ACH Enabled: False 1798 Labor - extinquisher recharge & mtc 269.50 06/24/2014 101-42200-440440 1798 Parts - extinquisher recharge & mtc 7.75 06/24/2014 101-42200-440440 277.25Check Total: Vendor:1153 ECM PUBLISHERS INC Check Sequence: 29 ACH Enabled: True 101378 ROP - Wine sale 5/8 230.00 06/24/2014 609-49754-434990 105782 Memorial Day ad 5/22 - 5/23 25.00 06/24/2014 609-49754-434990 108845 ORD 592A Summary - Swan River 6/5 129.22 06/24/2014 101-41910-435100 108846 ORD 594A Summary - R-4 Zoning 6/5 129.22 06/24/2014 101-41310-435100 108847 ORD 597 Amend City Code 6/5 138.45 06/24/2014 101-41310-435100 108848 ORD 598 City Code BCOL Council 6/5 175.37 06/24/2014 101-41310-435100 108849 ORD 595 Adopt Zoning Map 6/5 203.06 06/24/2014 101-41310-435100 108850 Summary ORD 596A 6/5 129.22 06/24/2014 101-41310-435100 99177 ROP - Wine sale 5/1 230.00 06/24/2014 609-49754-434990 1,389.54Check Total: Vendor:3755 THADDEAUS ENDE Check Sequence: 30 ACH Enabled: False FNM Refund FNM-001-0154 15.46 06/24/2014 655-00000-115025 15.46Check Total: Vendor:1680 EPIC PRODUCTS INC Check Sequence: 31 ACH Enabled: False AP-Computer Check Proof List by Vendor (06/18/2014 - 12:06 PM)Page 6 Invoice No Description Amount Payment Date Acct Number Reference 0448045-IN re-sale 179.40 06/24/2014 609-49750-425400 0448045-IN freight 22.53 06/24/2014 609-49750-433300 201.93Check Total: Vendor:1878 ESS BROTHERS & SONS INC Check Sequence: 32 ACH Enabled: False TT1506 (2) R-3290-7000 curb box only 3" 221.00 06/24/2014 101-43130-422420 221.00Check Total: Vendor:3767 TIM FAST Check Sequence: 33 ACH Enabled: False 6/6/14 6/5/14 Farmers Mkt performance 125.00 06/24/2014 226-45127-431990 125.00Check Total: Vendor:3318 FIBERNET MONTICELLO Check Sequence: 34 ACH Enabled: False 6/10/14 Bullseye 6/10/14 329.84 06/24/2014 655-49870-443980 6/10/14 Bullseye 6/10/14 interest -9.12 06/24/2014 655-00000-362990 320.72Check Total: Vendor:2273 FIBERNET MONTICELLO - ACH Check Sequence: 35 ACH Enabled: True 6/1/14 C.H. Phone June 2014 809.86 06/24/2014 702-00000-432100 6/1/14 C.H. Internet June 2014 99.95 06/24/2014 702-00000-432300 6/1/14 C.H. Data Hosting June 2014 500.00 06/24/2014 702-00000-431990 6/1/14 C.H. TV June 2014 13.60 06/24/2014 101-41310-431990 6/1/14 C.H. Repair/Mtc June 2014 250.00 06/24/2014 702-00000-440440 6/1/14 MCC Phone June 2014 741.74 06/24/2014 702-00000-432100 6/1/14 MCC Cable June 2014 294.10 06/24/2014 226-45122-432500 6/1/14 MCC Internet June 2014 10.00 06/24/2014 702-00000-432300 6/1/14 Ballfields Phone June 2014 50.20 06/24/2014 702-00000-432100 6/1/14 Ballfields Internet June 2014 69.95 06/24/2014 702-00000-432300 6/1/14 DMV Phone June 2014 287.79 06/24/2014 702-00000-432100 6/1/14 DMV Internet June 2014 41.95 06/24/2014 702-00000-432300 6/1/14 Hi-Way Liquor Phone June 2014 273.03 06/24/2014 702-00000-432100 6/1/14 Hi-Way Liquor Internet June 2014 41.95 06/24/2014 702-00000-432300 6/1/14 Fire Dept Phone June 2014 272.11 06/24/2014 702-00000-432100 6/1/14 Fire Dept Internet June 2014 41.95 06/24/2014 702-00000-432300 6/1/14 Animal Shelter Internet June 2014 29.95 06/24/2014 702-00000-432300 6/1/14 P.W. Phone June 2014 370.68 06/24/2014 702-00000-432100 6/1/14 P.W. Internet June 2014 69.95 06/24/2014 702-00000-432300 6/1/14 Parks Phone June 2014 113.21 06/24/2014 702-00000-432100 6/1/14 Prairie Center Phone June 2014 20.49 06/24/2014 702-00000-432100 6/1/14 Sheriff Dept Phone June 2014 68.53 06/24/2014 702-00000-432100 AP-Computer Check Proof List by Vendor (06/18/2014 - 12:06 PM)Page 7 Invoice No Description Amount Payment Date Acct Number Reference 6/1/14 Sheriff Dept Internet June 2014 41.95 06/24/2014 702-00000-432300 4,512.94Check Total: Vendor:2222 FOX SPORTS NET INC Check Sequence: 36 ACH Enabled: True H07528 Fox Sports North May 2014 4,770.17 06/24/2014 655-49860-430920 4,770.17Check Total: Vendor:2462 FOX TELEVISION STATIONS INC Check Sequence: 37 ACH Enabled: False KMSP May - 2014 KMSP May 2014 1,077.70 06/24/2014 655-49860-430920 1,077.70Check Total: Vendor:2462 FOX TELEVISION STATIONS INC Check Sequence: 38 ACH Enabled: False WFTC May - 2014 WFTC May 2014 207.25 06/24/2014 655-49860-430920 207.25Check Total: Vendor:3476 FS2 Check Sequence: 39 ACH Enabled: True H10484 FS2 May 2014 50.00 06/24/2014 655-49860-430920 50.00Check Total: Vendor:3748 JEFFREY D GARDNER Check Sequence: 40 ACH Enabled: True 6/13/14 Farmer's Mkt 30.00 06/24/2014 226-00000-220100 30.00Check Total: Vendor:3762 GARRETTS DIAMOND CITY BREAD Check Sequence: 41 ACH Enabled: True 6/13/14 Farmer's Mkt 50.00 06/24/2014 226-00000-220100 50.00Check Total: Vendor:1206 GRAPE BEGINNINGS INC Check Sequence: 42 ACH Enabled: False 167834 1,120.00 06/24/2014 609-49750-425300 167834 freight 15.75 06/24/2014 609-49750-433300 1,135.75Check Total: Vendor:1222 HARDRIVES INC Check Sequence: 43 ACH Enabled: False Refund Deposit - check 150696 receipted 4/15/14 #85354 1,500.00 06/24/2014 601-00000-220111 Refund Water usage charge 14900 gallons -434.68 06/24/2014 601-49440-371120 Refund Meter rental -100.00 06/24/2014 601-00000-362990 Refund -36.76 06/24/2014 601-00000-208100 AP-Computer Check Proof List by Vendor (06/18/2014 - 12:06 PM)Page 8 Invoice No Description Amount Payment Date Acct Number Reference 928.56Check Total: Vendor:2305 HOME BOX OFFICE Check Sequence: 44 ACH Enabled: True May - 14 HBO May 2014 311.64 06/24/2014 655-49860-430920 May - 14 HBO Cinemax May 2014 58.75 06/24/2014 655-49860-430920 May - 14 HBO Bulk May 2014 513.05 06/24/2014 655-49860-430920 883.44Check Total: Vendor:2214 HUBBARD BROADCASTING INC Check Sequence: 45 ACH Enabled: False KSTC May - 14 KSTC May - 14 373.05 06/24/2014 655-49860-430920 373.05Check Total: Vendor:2214 HUBBARD BROADCASTING INC Check Sequence: 46 ACH Enabled: False KSTP May - 14 KSTP May - 14 373.05 06/24/2014 655-49860-430920 373.05Check Total: Vendor:3749 DANIEL PAUL HUNZ Check Sequence: 47 ACH Enabled: True 6/13/14 Farmer's Mkt 45.00 06/24/2014 226-00000-220100 45.00Check Total: Vendor:3756 HAROLD AND DOROTHY HUTGREN Check Sequence: 48 ACH Enabled: False FNM Refund 763-295-3475 42.03 06/24/2014 655-00000-115025 42.03Check Total: Vendor:3369 JAKE'S EXCAVATING INC Check Sequence: 49 ACH Enabled: False 2520 5/18 - 5/28/14 (2) grave sites 850.00 06/24/2014 651-49010-431150 850.00Check Total: Vendor:1259 JJ TAYLOR DISTRIBUTING Check Sequence: 50 ACH Enabled: False 2225347 re sale 359.35 06/24/2014 609-49750-425200 359.35Check Total: Vendor:1263 JOHNSON BROS WHOLESALE LIQUOR Check Sequence: 51 ACH Enabled: False 1865136 re sale 2,654.33 06/24/2014 609-49750-425100 1865136 freight 30.58 06/24/2014 609-49750-433300 1865137 freight 59.78 06/24/2014 609-49750-433300 1865137 re salre 2,760.83 06/24/2014 609-49750-433300 AP-Computer Check Proof List by Vendor (06/18/2014 - 12:06 PM)Page 9 Invoice No Description Amount Payment Date Acct Number Reference 1865138 re sale 156.00 06/24/2014 609-49750-425200 1868203 re-sale 369.00 06/24/2014 609-49750-425200 1868204 re-sale 204.58 06/24/2014 609-49750-425100 1868204 freight 2.78 06/24/2014 609-49750-433300 1868205 freight 13.90 06/24/2014 609-49750-433300 1868205 re-sale 455.55 06/24/2014 609-49750-425300 1869511 re sale 80.00 06/24/2014 609-49750-425100 1869511 freight 1.39 06/24/2014 609-49750-433300 1869512 freight 47.96 06/24/2014 609-49750-433300 1869512 re sale 1,777.00 06/24/2014 609-49750-425300 1871591 freight 21.07 06/24/2014 609-49750-433300 1871591 re sale 2,024.14 06/24/2014 609-49750-425100 1871592 re sale 1,538.20 06/24/2014 609-49750-425300 1871592 freight 30.58 06/24/2014 609-49750-433300 1873730 freight 26.41 06/24/2014 609-49750-433300 1873730 re sale 863.55 06/24/2014 609-49750-425300 621225 re sale -540.00 06/24/2014 609-49750-425100 621225 freight -5.56 06/24/2014 609-49750-433300 621547 -96.00 06/24/2014 609-49750-425300 621547 -1.39 06/24/2014 609-49750-433300 12,474.68Check Total: Vendor:2251 KARE GANNETT CO INC Check Sequence: 52 ACH Enabled: False 297-1017 KARE May 2014 911.90 06/24/2014 655-49860-430920 911.90Check Total: Vendor:2626 HARRY LANTTO Check Sequence: 53 ACH Enabled: True 6/12/14 6/3/14 Planning Comm meeting recording 52.50 06/24/2014 101-41910-431990 6/12/14 6/11/14 EDA meeting recording 50.00 06/24/2014 213-46301-431990 102.50Check Total: Vendor:1291 LEAGUE OF MN CITIES INS TRUST Check Sequence: 54 ACH Enabled: False 6/1/14 LMCIT Claim #C0030655 date of injury 4/4/14 1,000.00 06/24/2014 101-49240-436990 1,000.00Check Total: Vendor:1292 LEROY JOB TRUCKING INC Check Sequence: 55 ACH Enabled: True 16662 (4) animal charge 46.80 06/24/2014 101-42700-431990 46.80Check Total: AP-Computer Check Proof List by Vendor (06/18/2014 - 12:06 PM)Page 10 Invoice No Description Amount Payment Date Acct Number Reference Vendor:3752 MARK LILLO Check Sequence: 56 ACH Enabled: False Escrow Refund ZFAITH - Escrow Refund 1,765.79 06/24/2014 101-00000-220110 Escrow Refund ZFAITH - Planning fee refund 150.00 06/24/2014 101-41910-322120 1,915.79Check Total: Vendor:1300 DOUGLAS WILLIAM LYSENG Check Sequence: 57 ACH Enabled: True 1278 Ballpark computer Serial #04212014A 1,068.75 06/24/2014 702-00000-424100 1278 Licenses/software 2,806.85 06/24/2014 702-00000-431990 1278 DMV switch & router; (6) keybd/mouse; (1) monitor 726.94 06/24/2014 702-00000-421990 1278 P.W. - (1) Epson 8350 Projector; wireless video unit 1,497.98 06/24/2014 101-43110-421990 1281 4/9 & 5/28/14 labor 490.88 06/24/2014 655-49870-431990 1281 (15) antivirus software; (7) keybd/mouse; (5) laptop case; ect. 3,876.71 06/24/2014 655-49870-420990 10,468.11Check Total: Vendor:1303 M AMUNDSON LLP Check Sequence: 58 ACH Enabled: True 175280 re-sale 32.78 06/24/2014 609-49750-425500 175280 re-sale 1,228.71 06/24/2014 609-49750-425400 1,261.49Check Total: Vendor:3770 MANKATO NETWORKS LLC Check Sequence: 59 ACH Enabled: False 386705 ARIN 0027 CHANTILLY VA (assignment of FNM IP address) 550.00 06/24/2014 655-49870-443700 386705 May 30 (1) hr - ARIN ASN filing fee 474.75 06/24/2014 655-49870-431990 386711 Replacemt equip-(1) router; (2) switch (old equpmt to be sold) 83,397.77 06/24/2014 655-49870-440440 386711 utx - shipping - Replacemt equip-(1) router; (2) switch 69.33 06/24/2014 655-49870-440440 84,491.85Check Total: Vendor:1309 MARTIE'S FARM SERVICE INC Check Sequence: 60 ACH Enabled: False 260800 (1) vet wrap; (1) spray nozzle; ect. 31.36 06/24/2014 101-42700-421990 31.36Check Total: Vendor:1314 MCDOWALL COMPANY Check Sequence: 61 ACH Enabled: False 218994 Maintenance Agreement Contract No: CO519 300.00 06/24/2014 101-45501-431900 218995 Maintenance Agreement Contract No: CO517 386.00 06/24/2014 655-49870-431900 218996 Maintenance Agreement Contract No: CO518 150.00 06/24/2014 101-41941-431900 219031 Maintenance Agreement Contract No: CO520 424.75 06/24/2014 226-45122-431900 1,260.75Check Total: Vendor:2111 MCFOA Check Sequence: 62 ACH Enabled: False AP-Computer Check Proof List by Vendor (06/18/2014 - 12:06 PM)Page 11 Invoice No Description Amount Payment Date Acct Number Reference Membership 7/1/14-6/30/14 K.B. 35.00 06/24/2014 101-41310-443300 Membership 7/1/14-6/30/14 C.S. 35.00 06/24/2014 101-41310-443300 70.00Check Total: Vendor:3757 BRIDGET AND BRANDON MCGRIFF Check Sequence: 63 ACH Enabled: False FNM Refund FNM-001-0763 11.29 06/24/2014 655-00000-115025 11.29Check Total: Vendor:1318 JONATHAN CALEB MELLBERG Check Sequence: 64 ACH Enabled: True 6/12/14 6/9/14 City Council meeting recording 80.00 06/24/2014 101-41110-431990 80.00Check Total: Vendor:2215 METRO GOLDWYN MAYER INC Check Sequence: 65 ACH Enabled: True May - 14 MGM HD May 2014 57.59 06/24/2014 655-49860-430920 57.59Check Total: Vendor:1920 MFRA - MCCOMBS FRANK ROOS ASSOC INC Check Sequence: 66 ACH Enabled: True 02999 General Planning 4/25/14 - Zoning map data to WSB 79.50 06/24/2014 101-41910-431990 79.50Check Total: Vendor:1327 MIDSTATES EQUIPMENT & SUPPLY Check Sequence: 67 ACH Enabled: False 214319 (1) 2" gate valve; (2) 2" gasket 147.87 06/24/2014 101-43120-422100 214333 (1) material pump direct drive 20GPM #120803; (2) gasket 1,326.00 06/24/2014 101-43120-422100 1,473.87Check Total: Vendor:1328 MIDWAY IRON & METAL CO INC Check Sequence: 68 ACH Enabled: False 235806 (2) 4'x6' floor plate 3/16 allum; (1) 6' PI SCH40 3/4 alum 403.51 06/24/2014 101-43127-421500 403.51Check Total: Vendor:3761 CHERYL MIKKELSON Check Sequence: 69 ACH Enabled: False Refund Cancel garden plot 25.26 06/24/2014 226-45122-347920 Refund Cancel garden plot 1.74 06/24/2014 226-00000-208100 27.00Check Total: Vendor:2179 MINNESOTA 9-1-1 PROGRAM Check Sequence: 70 ACH Enabled: True May - 14 May 2014 911 Wright Co 880.44 06/24/2014 655-00000-208170 AP-Computer Check Proof List by Vendor (06/18/2014 - 12:06 PM)Page 12 Invoice No Description Amount Payment Date Acct Number Reference 880.44Check Total: Vendor:2653 MINNESOTA SECRETARY OF STATE - NOTARY Check Sequence: 71 ACH Enabled: False 6/4/14 Notary Commission - Carolyn Granger 120.00 06/24/2014 217-41990-431990 120.00Check Total: Vendor:2217 MLB NETWORK LLC AFFILIATE SALE Check Sequence: 72 ACH Enabled: False 040114 MLB May 2014 288.40 06/24/2014 655-49860-430920 288.40Check Total: Vendor:1343 MN DEPT OF COMMERCE Check Sequence: 73 ACH Enabled: False 1000027333 #6726 - Indirect Assessment 1st Qtr FY 2015 135.55 06/24/2014 655-49870-443700 135.55Check Total: Vendor:1369 MONTICELLO CHAMBER OF COMMERCE Check Sequence: 74 ACH Enabled: False 6807a Kiosk rental - both sides for swim lessons 30.00 06/24/2014 226-45127-434990 30.00Check Total: Vendor:1377 MONTICELLO SENIOR CENTER Check Sequence: 75 ACH Enabled: True June 2014 Monthly appropriation 4,375.00 06/24/2014 101-45175-444310 4,375.00Check Total: Vendor:1379 MONTICELLO UMPIRES ASSOCIATION Check Sequence: 76 ACH Enabled: True 2014-3 (51) games Men's League Monday & Tuesday night umpires 1,428.00 06/24/2014 226-45127-430160 1,428.00Check Total: Vendor:1821 MOOSE SHERRITT ICE ARENA Check Sequence: 77 ACH Enabled: False 6/12/14 Hockey League - 50% of net profits 4,091.71 06/24/2014 226-45127-430130 4,091.71Check Total: Vendor:1629 MP NEXLEVEL LLC Check Sequence: 78 ACH Enabled: True 112492 (280) ft material; directional bore duct; winter adder 2,800.00 06/24/2014 656-49877-431990 112493 (4) hr operator; laborer; 1 ton truck; (20) ft material 440.44 06/24/2014 656-49877-431990 3,240.44Check Total: Vendor:3422 MUNICIPAL BUILDERS INC Check Sequence: 79 ACH Enabled: False AP-Computer Check Proof List by Vendor (06/18/2014 - 12:06 PM)Page 13 Invoice No Description Amount Payment Date Acct Number Reference Voucher 12 12C003 - Voucher 12 - WWTF Sludge Dewatering Facility 7,001.47 06/24/2014 602-00000-165010 7,001.47Check Total: Vendor:2218 MUSIC CHOICE Check Sequence: 80 ACH Enabled: True May - 14 Music Choice May 2014 217.65 06/24/2014 655-49860-430920 217.65Check Total: Vendor:2275 NATIONAL GEOGRAPHIC WILD Check Sequence: 81 ACH Enabled: True H11303 National Geographic Wild May 2014 50.00 06/24/2014 655-49860-430920 50.00Check Total: Vendor:2072 NATIONAL TELCO TELEVISION CONSORTIUM Check Sequence: 82 ACH Enabled: True 2313 NTTC - May 2014 27,788.62 06/24/2014 655-49860-430920 27,788.62Check Total: Vendor:3138 NBC UNIVERSAL Check Sequence: 83 ACH Enabled: True 770717 Bravo May 2014 302.82 06/24/2014 655-49860-430920 770719 Chiller May 2014 28.73 06/24/2014 655-49860-430920 770720 CLOO May 2014 28.73 06/24/2014 655-49860-430920 770721 CNBC May 2014 540.75 06/24/2014 655-49860-430920 770723 CNBC World May 2014 25.00 06/24/2014 655-49860-430920 770724 E! May 2014 292.01 06/24/2014 655-49860-430920 770726 Esquire May 2014 209.09 06/24/2014 655-49860-430920 770728 G4 May 2014 140.60 06/24/2014 655-49860-430920 770732 MSNBC May 2014 418.18 06/24/2014 655-49860-430920 770733 MUN2 May 2014 37.62 06/24/2014 655-49860-430920 770734 Olympics May 2014 129.78 06/24/2014 655-49860-430920 770735 Oxygen May 2014 277.59 06/24/2014 655-49860-430920 770738 SYFY May 2014 349.69 06/24/2014 655-49860-430920 770739 Golf Channel May 2014 346.08 06/24/2014 655-49860-430920 770740 Telemundo May 2014 51.30 06/24/2014 655-49860-430920 770741 Universal HD May 2014 95.04 06/24/2014 655-49860-430920 770743 USA May 2014 1,063.48 06/24/2014 655-49860-430920 770744 NBC Sports Network May 2014 266.77 06/24/2014 655-49860-430920 773964 PBS Kids Sprout May 2014 25.00 06/24/2014 655-49860-430920 4,628.26Check Total: Vendor:3758 ERIN AND RORY NEBBEN Check Sequence: 84 ACH Enabled: False FNM Refund 763-295-6084 12.95 06/24/2014 655-00000-115025 AP-Computer Check Proof List by Vendor (06/18/2014 - 12:06 PM)Page 14 Invoice No Description Amount Payment Date Acct Number Reference 12.95Check Total: Vendor:3759 CURTIS NEUENSCHWANDER Check Sequence: 85 ACH Enabled: False FNM Refund FNM-001-0285 13.88 06/24/2014 655-00000-115025 13.88Check Total: Vendor:2082 NEUSTAR INC Check Sequence: 86 ACH Enabled: True Account: 20313 Invoice M-10716481 SOW charges 5/1-5/31/14 2.59 06/24/2014 655-49870-431990 Account: 20313 Invoice M-10716482 LNP charges 5/1-5/31/14 131.49 06/24/2014 655-49870-431990 134.08Check Total: Vendor:2082 NEUSTAR INC Check Sequence: 87 ACH Enabled: True Account: 19894 Invoice M-10716367 LNP charges 5/1-5/31/14 210.00 06/24/2014 655-49870-431990 210.00Check Total: Vendor:2216 NHL NETWORK Check Sequence: 88 ACH Enabled: False May - 14 NHL May 2025 240.09 06/24/2014 655-49860-430920 240.09Check Total: Vendor:1401 NORTHWEST ASSOCIATED CONSULTANTS INC Check Sequence: 89 ACH Enabled: True 21324 General - PUD Ordinance Update 1,447.80 06/24/2014 101-41910-431990 21324 General 1,007.74 06/24/2014 101-41910-431990 21326 Meetings - 5/6/14 Planning Comm; 5/27/14 CCT meeting 300.00 06/24/2014 101-41910-431990 2,755.54Check Total: Vendor:3768 JACOB OLINGER Check Sequence: 90 ACH Enabled: False 2/8/14 Reimb 2/8/14 Hampton Inn stay-Alex MN Fire Chiefs officer school 142.79 06/24/2014 101-42200-433100 142.79Check Total: Vendor:3738 DANIEL D OLSEN Check Sequence: 91 ACH Enabled: True Mon03 May 2014 3,630.00 06/24/2014 655-49870-430700 3,630.00Check Total: Vendor:1412 OMANN BROTHERS INC Check Sequence: 92 ACH Enabled: False 10776 (1.02) 1/2' # 2341 AC mix 56.30 06/24/2014 101-43120-422400 56.30Check Total: AP-Computer Check Proof List by Vendor (06/18/2014 - 12:06 PM)Page 15 Invoice No Description Amount Payment Date Acct Number Reference Vendor:2131 ONVOY VOICE SERVICES Check Sequence: 93 ACH Enabled: True 140602008669 Voice - 6/2-7/1/14 A-Links; 5/25/14 Dips 1,346.79 06/24/2014 655-49860-430910 1,346.79Check Total: Vendor:2131 ONVOY VOICE SERVICES Check Sequence: 94 ACH Enabled: True 140602010659 Voice - Operator Services; Wholesale Switching & 800 Switched 460.72 06/24/2014 655-49860-430910 460.72Check Total: Vendor:1419 PAN O GOLD CO ST CLOUD Check Sequence: 95 ACH Enabled: True 10004415806 re-sale 31.32 06/24/2014 226-45127-425410 31.32Check Total: Vendor:1674 JAMIE ANN PAULSON Check Sequence: 96 ACH Enabled: True 14413 (3) crest logo; rush charge 31.00 06/24/2014 655-49870-421110 14413 (3) Dry-zone polo 65.94 06/24/2014 655-49870-421110 96.94Check Total: Vendor:1273 PAUSTIS & SONS WINE CO Check Sequence: 97 ACH Enabled: False 8452722 re sale 1,280.22 06/24/2014 609-49750-425300 8452722 freight 17.50 06/24/2014 609-49750-433300 1,297.72Check Total: Vendor:1427 PHILLIPS WINE & SPIRITS CO Check Sequence: 98 ACH Enabled: False 2613755 re-sale 3,952.61 06/24/2014 609-49750-425100 2613755 freight 47.96 06/24/2014 609-49750-433300 2613756 freight 47.27 06/24/2014 609-49750-433300 2613756 re-sale 1,265.40 06/24/2014 609-49750-425300 2613756 re-sale 56.00 06/24/2014 609-49750-425400 2613756 re-sale 102.45 06/24/2014 609-49750-425100 2615866 re-sale 660.00 06/24/2014 609-49750-425100 2615866 freight 4.17 06/24/2014 609-49750-433300 2615867 freight 13.90 06/24/2014 609-49750-433300 2615867 re-sale 840.00 06/24/2014 609-49750-425300 2616676 re sale 829.85 06/24/2014 609-49750-425100 2616676 freight 12.51 06/24/2014 609-49750-433300 2616677 freight 87.34 06/24/2014 609-49750-433300 2616677 re sale 6,185.94 06/24/2014 609-49750-425300 2618094 re sale 1,079.38 06/24/2014 609-49750-425100 2618094 freight 16.33 06/24/2014 609-49750-433300 AP-Computer Check Proof List by Vendor (06/18/2014 - 12:06 PM)Page 16 Invoice No Description Amount Payment Date Acct Number Reference 2618095 re sale 567.95 06/24/2014 609-49750-425300 2618095 re sale 72.00 06/24/2014 609-49750-425100 2618095 re sale 41.95 06/24/2014 609-49750-425400 2618095 freight 27.80 06/24/2014 609-49750-433300 2619574 freight 29.19 06/24/2014 609-49750-433300 2619574 re sale 1,420.50 06/24/2014 609-49750-425100 2619575 freight 6.95 06/24/2014 609-49750-433300 2619575 re sale 339.65 06/24/2014 609-49750-425300 3527837 -203.00 06/24/2014 609-49750-425100 3527837 -1.39 06/24/2014 609-49750-433300 3528249 -261.75 06/24/2014 609-49750-425100 3528249 -1.39 06/24/2014 609-49750-433300 3528343 re sale -85.00 06/24/2014 609-49750-425100 3528343 freight -1.39 06/24/2014 609-49750-433300 3528582 -119.30 06/24/2014 609-49750-425100 3528582 -1.39 06/24/2014 609-49750-433300 17,032.49Check Total: Vendor:1470 RUSSELL SECURITY RESOURCE INC Check Sequence: 99 ACH Enabled: True A23486 Parts & labor - replaced breakroom keypad lock 831.03 06/24/2014 609-49754-440100 831.03Check Total: Vendor:1474 PATRICIA A SALZWEDEL Check Sequence: 100 ACH Enabled: True 5/1-5/30/14 Mileage reimbursement 5/1-5/30/14 168.00 06/24/2014 101-42700-433100 5/1-5/30/14 Reimb 4/12/14 Budget Pet care - (1) 12 pk Frontline Plus; ect. 135.83 06/24/2014 101-42700-421990 6/30/14 Contract 1,593.75 06/24/2014 101-42700-431200 1,897.58Check Total: Vendor:2443 SECURITAS SECURITY SERVICES USA INC Check Sequence: 101 ACH Enabled: False W4389438 5/16/14 Godrey wedding R2221; 5/17/14 Lukkar wedding R2121 359.11 06/24/2014 226-45122-431992 W4397080 5/24/14 Eden wedding R2103 179.56 06/24/2014 226-45122-431992 W4404331 5/30/14 Bahr wedding R2083 179.56 06/24/2014 226-45122-431992 718.23Check Total: Vendor:1485 SENTRY SYSTEMS INC Check Sequence: 102 ACH Enabled: False 690608 6/1/14-5/31/15 commercial monitoring services 180.00 06/24/2014 101-43110-431900 180.00Check Total: Vendor:2301 SHOWTIME NETWORKS INC Check Sequence: 103 ACH Enabled: False AP-Computer Check Proof List by Vendor (06/18/2014 - 12:06 PM)Page 17 Invoice No Description Amount Payment Date Acct Number Reference 201405-40843608 Showtime May 2014 138.27 06/24/2014 655-49860-430920 138.27Check Total: Vendor:3769 SIGNATURE PAINTING INC Check Sequence: 104 ACH Enabled: False 6/12/14 Gallery hallway - painting services 300.00 06/24/2014 226-45122-431120 300.00Check Total: Vendor:1958 SIMPLEXGRINNELL LP Check Sequence: 105 ACH Enabled: False 76834253 4/1/14-3/31/15 H.E. Bldg - fire suppression system 1,501.41 06/24/2014 655-49870-431900 1,501.41Check Total: Vendor:2212 SINCLAIR TELEVISION GROUP INC Check Sequence: 106 ACH Enabled: False May - 14 WUCW May 2014 298.44 06/24/2014 655-49860-430920 298.44Check Total: Vendor:3309 SOUTHERN WINE & SPIRITS OF MINNESOTA Check Sequence: 107 ACH Enabled: False 1168528 re sale 1,834.28 06/24/2014 609-49750-425100 1168528 freight 15.00 06/24/2014 609-49750-433300 1168530 freight 46.24 06/24/2014 609-49750-433300 1168530 re-sale 3,198.92 06/24/2014 609-49750-425300 1170903 freight 8.75 06/24/2014 609-49750-433300 1170903 re sale 864.20 06/24/2014 609-49750-425100 1170905 re sale 788.00 06/24/2014 609-49750-425300 1170905 freight 11.25 06/24/2014 609-49750-433300 9036270 -35.60 06/24/2014 609-49750-425400 6,731.04Check Total: Vendor:1937 CITY OF ST MICHAEL Check Sequence: 108 ACH Enabled: False 03062014-1 (6917) lbs NUVO crack seal product 4,357.71 06/24/2014 101-43120-422400 4,357.71Check Total: Vendor:3760 LUVERNE SWEEP Check Sequence: 109 ACH Enabled: False FNM Refund FNM-001-0207 33.82 06/24/2014 655-00000-115025 33.82Check Total: Vendor:1518 TDS TELECOM Check Sequence: 110 ACH Enabled: True 665-837-0005 Voice - nonpublished number charges 84.00 06/24/2014 655-49860-430910 AP-Computer Check Proof List by Vendor (06/18/2014 - 12:06 PM)Page 18 Invoice No Description Amount Payment Date Acct Number Reference 84.00Check Total: Vendor:1518 TDS TELECOM Check Sequence: 111 ACH Enabled: True 665-838-0000 Voice - nonpublished number charges 259.00 06/24/2014 655-49860-430910 665-838-0000 Voice - LNP conversion charges 40.00 06/24/2014 655-49870-432600 299.00Check Total: Vendor:1518 TDS TELECOM Check Sequence: 112 ACH Enabled: True 763-295-2005 17.95 06/24/2014 702-00000-432100 17.95Check Total: Vendor:1518 TDS TELECOM Check Sequence: 113 ACH Enabled: True 763-271-3230 100.86 06/24/2014 702-00000-432100 100.86Check Total: Vendor:1518 TDS TELECOM Check Sequence: 114 ACH Enabled: True 763-295-4054 46.56 06/24/2014 702-00000-432100 46.56Check Total: Vendor:1518 TDS TELECOM Check Sequence: 115 ACH Enabled: True 763-295-3714 329.86 06/24/2014 702-00000-432100 329.86Check Total: Vendor:1518 TDS TELECOM Check Sequence: 116 ACH Enabled: True 763-271-3257 90.37 06/24/2014 702-00000-432100 90.37Check Total: Vendor:1522 THORPE DISTRIBUTING COMPANY Check Sequence: 117 ACH Enabled: True 827248 re sale 131.20 06/24/2014 609-49750-425400 827249 re sale 70.80 06/24/2014 609-49750-425300 827249 re sale 161.25 06/24/2014 609-49750-425200 827251 re-sale 14,604.40 06/24/2014 609-49750-425200 828792 re sale 93.00 06/24/2014 609-49750-425400 828795 re sale 15,205.85 06/24/2014 609-49750-425200 30,266.50Check Total: Vendor:2252 TOWER DISTRIBUTION COMPANY Check Sequence: 118 ACH Enabled: False AP-Computer Check Proof List by Vendor (06/18/2014 - 12:06 PM)Page 19 Invoice No Description Amount Payment Date Acct Number Reference 360080 WGN May 2014 207.55 06/24/2014 655-49860-430920 207.55Check Total: Vendor:2165 TV GUIDE NETWORKS LLC TV GUIDE ENTERTAINMENT GROUP LLC Check Sequence: 119 ACH Enabled: True 139257 TV Guide Network May 2014 444.14 06/24/2014 655-49860-430920 444.14Check Total: Vendor:2534 VAULTAS ALEXANDRIA LLC Check Sequence: 120 ACH Enabled: True 1832 July 2014 Gigabit Transport; Cross Connects; Ethernet line 4,400.00 06/24/2014 655-49860-430930 1832 June 2014 Cross Connect; Ethernet private line 1,900.00 06/24/2014 655-49860-430930 1832 November 2013 Cross Connect; Racks 349.00 06/24/2014 655-49860-430930 1832 Ethernet private line & Cross connect installation 1,245.00 06/24/2014 655-49860-430930 7,894.00Check Total: Vendor:1552 VIKING COCA COLA BOTTLING CO Check Sequence: 121 ACH Enabled: True 1404843 re sale 201.60 06/24/2014 609-49750-425400 1404989 re sale 316.20 06/24/2014 609-49750-425400 517.80Check Total: Vendor:1684 VINOCOPIA Check Sequence: 122 ACH Enabled: True 0100101-IN re-sale 416.00 06/24/2014 609-49750-425300 0100101-IN freight 12.00 06/24/2014 609-49750-433300 100528 re sale 608.00 06/24/2014 609-49750-425300 100528 re sale 462.75 06/24/2014 609-49750-425100 100528 freight 20.00 06/24/2014 609-49750-433300 1,518.75Check Total: Vendor:3357 VUBIQUITY Check Sequence: 123 ACH Enabled: True May - 14 PPV and VOD May 2014 875.59 06/24/2014 655-49860-430920 875.59Check Total: Vendor:1561 WATER LABORATORIES INC Check Sequence: 124 ACH Enabled: False 4295 May 2014 water testing 225.00 06/24/2014 601-49440-422740 225.00Check Total: Vendor:1564 BRIAN WELDON Check Sequence: 125 ACH Enabled: True 6/5-6/6/14 Mileage reimb - (2) trips St Cloud - Electric Motor & Goodin Co 51.13 06/24/2014 226-45122-433100 AP-Computer Check Proof List by Vendor (06/18/2014 - 12:06 PM)Page 20 Invoice No Description Amount Payment Date Acct Number Reference 51.13Check Total: Vendor:1572 THE WINE COMPANY Check Sequence: 126 ACH Enabled: True 363203 re sale 700.00 06/24/2014 609-49750-425300 363203 freight 11.55 06/24/2014 609-49750-433300 364111 re sale 480.00 06/24/2014 609-49750-425300 364111 freight 8.25 06/24/2014 609-49750-433300 1,199.80Check Total: Vendor:1573 WINE MERCHANTS INC Check Sequence: 127 ACH Enabled: False 505980 freight 45.18 06/24/2014 609-49750-433300 505980 re-sale 2,385.18 06/24/2014 609-49750-425300 506914 re sale 648.00 06/24/2014 609-49750-425300 506914 freight 6.95 06/24/2014 609-49750-433300 3,085.31Check Total: Vendor:1209 WIRTZ BEVERAGE MINNESOTA WINE & SPIRITS Check Sequence: 128 ACH Enabled: False 1080188611 freight 57.48 06/24/2014 609-49750-433300 1080188611 re-sale 3,156.18 06/24/2014 609-49750-425100 1080188611 re-sale 829.98 06/24/2014 609-49750-425300 1080191479 re sale 680.23 06/24/2014 609-49750-425300 1080191479 re sale 3,452.81 06/24/2014 609-49750-425100 1080191479 freight 68.47 06/24/2014 609-49750-433300 8,245.15Check Total: Vendor:2219 WORLD FISHING NETWORK LTD Check Sequence: 129 ACH Enabled: True 550-1013 World Fishing Network May 2014 30.42 06/24/2014 655-49860-430920 30.42Check Total: Vendor:1577 WRIGHT CO AUDITOR-TREAS - ACH Check Sequence: 130 ACH Enabled: True June June 2014 91,250.00 06/24/2014 101-42100-430500 91,250.00Check Total: Vendor:1581 WRIGHT CO RECORDER Check Sequence: 131 ACH Enabled: False 201400000047 ZBATCH - A 1262609 Permit (Miscellaneous) 46.00 06/24/2014 101-41910-431990 201400000047 ZWEESE - A 1262839 Variance D. Weese 46.00 06/24/2014 101-41910-431990 92.00Check Total: AP-Computer Check Proof List by Vendor (06/18/2014 - 12:06 PM)Page 21 Invoice No Description Amount Payment Date Acct Number Reference Vendor:1580 WRIGHT COUNTY JOURNAL PRESS Check Sequence: 132 ACH Enabled: False 8057880 All Wines ...-full 5/4; 5/11 781.26 06/24/2014 609-49754-434990 781.26Check Total: Vendor:3764 WRIGHT COUNTY REGISTRAR OF TITLES Check Sequence: 133 ACH Enabled: False 201400000004 ZHSPIR - T 30480 Conditional Use Proceed 46.00 06/24/2014 101-41910-431990 46.00Check Total: Vendor:1583 WRIGHT HENNEPIN COOP ELECTRIC ASSOCIATION Check Sequence: 134 ACH Enabled: True 10710177100 5/1-6/1/14 88.56 06/24/2014 602-49490-438100 10710177100 August 2014 service 19.95 06/24/2014 217-41990-431900 10710177100 August 2014 service 36.45 06/24/2014 101-45201-431900 10710177100 August 2014 service 27.95 06/24/2014 101-42200-431900 10710177100 August 2014 service 19.95 06/24/2014 601-49440-431900 10710177100 utx - August 2014 service 27.95 06/24/2014 226-45122-431900 10710177100 August 2014 service 32.95 06/24/2014 601-49440-431900 10710177100 August 2014 service 29.95 06/24/2014 601-49440-431900 10710177100 August 2014 service 19.95 06/24/2014 601-49440-431900 10710177100 utx - August 2014 service (M.T. cancelled 6/4/14-to be credited) 27.95 06/24/2014 101-41940-431900 10710177100 August 2014 service 19.95 06/24/2014 101-45201-431900 10710177100 1,337.74 06/24/2014 101-43160-438100 1,689.30Check Total: Vendor:1584 WSB & ASSOCIATES INC Check Sequence: 135 ACH Enabled: True 025960003 ArcGIS Upgrade 2,260.50 06/24/2014 101-43111-430300 116061168 10C009 - Traffic Eng Services 2,260.50 06/24/2014 400-43300-459010 149448030 ZRCFOS - Fallon Overpass 294.00 06/24/2014 101-43111-430300 149458022 10C010 - Great River Trailways/Trailhd(Per A.M. 5/28/14 expense) 621.00 06/24/2014 101-43111-430300 149470013 General WWTP 393.50 06/24/2014 602-49480-430300 149472010 Economic Development & Market Matching 4,000.00 06/24/2014 213-46301-430300 14947609 ZTOWER - Comm Tower - proj mgmt/coord 1,311.00 06/24/2014 101-41910-430300 14947709 ZZALDI - Aldi Plan Review 138.00 06/24/2014 101-00000-220110 14947805 ZSWPPP - MS4/SWPPP Services Ph 02 2014 1,574.00 06/24/2014 101-43111-430300 14948004 10C009 - CSAH 75/TH 25 Intersection Improvemts Ph 1 Feasibility 441.00 06/24/2014 400-43300-459010 14948103 Z12PMP - 2013 Pavement Mgmt Program 166.00 06/24/2014 101-43111-430300 14948402 ZPINE2 - Pineview 2nd Addn Plan Review 69.00 06/24/2014 101-00000-220110 14948503 ZZSRCS - Swan River School Expansion 2,171.50 06/24/2014 101-00000-220110 14948704 12C008 - Hillside Farms 3rd & 4th Public Impr 3,319.75 06/24/2014 400-43300-459010 14948803 Wellhead Protection Plan Amendment 3,536.78 06/24/2014 101-43111-430300 14948901 ZGOODW - Goodwill Plan Review 2,032.50 06/24/2014 101-00000-220110 AP-Computer Check Proof List by Vendor (06/18/2014 - 12:06 PM)Page 22 Invoice No Description Amount Payment Date Acct Number Reference 162751029 12C002 - 7th St (Elm to Minn) Ext 458.00 06/24/2014 101-43111-430300 25,047.03Check Total: Vendor:1907 XO COMMUNICATIONS LLC Check Sequence: 136 ACH Enabled: True 0267821108 Data - Internet access 6/1-6/30/14 5,004.87 06/24/2014 655-49860-430930 5,004.87Check Total: Vendor:1907 XO COMMUNICATIONS LLC Check Sequence: 137 ACH Enabled: True 0267933474 Data - Internet access 6/1-6/30/14 2,245.57 06/24/2014 655-49860-430930 2,245.57Check Total: Vendor:2076 ZAYO BANDWIDTH LLC Check Sequence: 138 ACH Enabled: True 003293 6/14 6/1-6/30/14 Private Line; Cost Recovery Surcharges 2,237.36 06/24/2014 655-49860-430910 2,237.36Check Total: Vendor:1588 ZEE MEDICAL SERVICE Check Sequence: 139 ACH Enabled: True 54096754 (1) 250 Ibutab 28.50 06/24/2014 609-49754-420650 54096755 (1) 2x50 Advil Liquigel; (1) 50/bx cough drops 42.90 06/24/2014 655-49870-420650 71.40Check Total: Total for Check Run: Total of Number of Checks: 480,179.20 139 AP-Computer Check Proof List by Vendor (06/18/2014 - 12:06 PM)Page 23 The preceding list of bills payable was reviewed and approved for payment. Date: 6/23/14 Approved by: _____________________________________ Mayor Clint Herbst User: Printed:06/18/2014 - 2:08PM Ann.Zimmerman Computer Check Proof List by Vendor Accounts Payable Batch:00201.06.2014 - 201.06.2014 June US Bank Invoice No Description Amount Payment Date Acct Number Reference Vendor:1604 HEALTH PARTNERS Check Sequence: 1 ACH Enabled: True 48318009 July 2014 51,138.23 06/15/2014 101-00000-217060 48318009 July 2014 5,550.80 06/15/2014 101-00000-217062 56,689.03Check Total: Vendor:3241 LINCOLN FINANCIAL GROUP Check Sequence: 2 ACH Enabled: True 6/1/14 June 2014 1,684.51 06/15/2014 101-00000-217066 1,684.51Check Total: Vendor:2811 US BANK CORPORATE PMT SYSTEM Check Sequence: 3 ACH Enabled: True 6/6/14 OfficeMax - (1) FDX Ground Com - SI RMA shipping 31.06 06/15/2014 655-49870-432200 6/6/14 OfficeMax - (1) 14" wall clock 22.43 06/15/2014 101-43127-421990 6/6/14 Moon Motors - (1) deluxe single harne P/N 39.50 06/15/2014 101-43127-422100 6/6/14 Paulson dba AST Sports - (2) clicker counter 15.00 06/15/2014 101-43115-421990 6/6/14 Paulson dba AST Sports - (5) clothing with names/logo embroidery 136.75 06/15/2014 101-42400-421110 6/6/14 Monticello NAPA - '08 Chev Silverado - (1) slide window 44.95 06/15/2014 101-43115-422110 6/6/14 Monticello NAPA - filters - (2) oil; (3) hydraulic 81.23 06/15/2014 101-45201-422100 6/6/14 Monticello NAPA -2000 F350-brake pads (1) front; (1) rear (1/2) 58.78 06/15/2014 601-49440-422110 6/6/14 Monticello NAPA -2000 F350-brake pads (1) front; (1) rear (1/2) 58.77 06/15/2014 602-49490-422110 6/6/14 Monticello NAPA -2000 F350 - fuel pump assy (1/2) 87.66 06/15/2014 602-49490-422110 6/6/14 Monticello NAPA -2000 F350 - fuel pump assy (1/2) 87.66 06/15/2014 601-49440-422110 6/6/14 utx - Home Depot - Warehouse-(5) 10' gal drywall corner bead 9.90 06/15/2014 226-45122-422300 6/6/14 Home Depot - (1) 2pc M18 compact combo kit 212.68 06/15/2014 656-49877-421990 6/6/14 Martie's Farm Serv - (6) 4-6-4 fertilizer 174.00 06/15/2014 101-45201-421600 6/6/14 Fastenal - (10) 17oz flo pink marking paint 50.18 06/15/2014 101-43115-421990 6/6/14 Home Depot - TV monitor-(1) shelf; (1) 9' ext cord; toggles; ect 56.35 06/15/2014 655-49870-421990 6/6/14 Arctic Glacier - re-sale 103.52 06/15/2014 609-49750-425500 6/6/14 SuperAm - (1) gift card - prize for Safety Bingo 25.00 06/15/2014 101-41800-443990 6/6/14 J H Larson Co - (27) assorted light bulbs & ballasts 159.84 06/15/2014 226-45122-422990 6/6/14 J H Larson Co - (37) assorted light bulbs 68.46 06/15/2014 226-45122-422990 6/6/14 Home Depot - (6) 10' rebar; (1) 2pk filter (1/2) 36.58 06/15/2014 601-49440-422300 AP-Computer Check Proof List by Vendor (06/18/2014 - 2:08 PM)Page 1 Invoice No Description Amount Payment Date Acct Number Reference 6/6/14 Home Depot - (6) 10' rebar; (1) 2pk filter (1/2) 36.58 06/15/2014 602-49490-421990 6/6/14 Home Depot - Hillcrest storage shed-(1) deadbolt; (4) keys; ect. 43.50 06/15/2014 101-45201-422300 6/6/14 utx - Home Depot - Warehouse storage wall - supplies 22.12 06/15/2014 226-45122-422300 6/6/14 Home Depot - (2) 6pc bundle 2x2-24" grade stakes 10.94 06/15/2014 601-49440-421990 6/6/14 NBP - (1) organizer - T.M.; (2) scissors; (6) tape; ect. 222.08 06/15/2014 226-45122-420990 6/6/14 Monticello NAPA - #123 Router (2) Super HD Ind 59.36 06/15/2014 101-43120-422100 6/6/14 Monticello NAPA - #226 & #228 - (1) hydo oil (returned 5/14/14) 51.84 06/15/2014 101-45201-422100 6/6/14 Holiday - (9.583) gallons 5/6/14 - G.D. 33.91 06/15/2014 217-41990-421200 6/6/14 Holiday - (9.806) gallons 5/13/14 - P.T. 34.31 06/15/2014 217-41990-421200 6/6/14 Monticello NAPA - (24) NAPA quart 5W 83.28 06/15/2014 101-43127-421300 6/6/14 Marties Farm Serv - (1) Treflan 38.00 06/15/2014 101-43120-422500 6/6/14 USPS - (1) 11.4 oz First Class mail large env - grant app 3.29 06/15/2014 226-45122-432200 6/6/14 Total Recreation - Warehouse-(12) pk foosballs 19.33 06/15/2014 226-45127-420750 6/6/14 Fastenal - (1) XL 3 pc rainsuit 15.10 06/15/2014 101-43120-421110 6/6/14 Fastenal - (1) retract bld util knife 4.82 06/15/2014 101-43120-421990 6/6/14 All Clean Dry Cleaners - (8) uniform jackets 33.45 06/15/2014 609-49754-431990 6/6/14 G & K Services - inv 1043701774 floor mat cleaning 64.06 06/15/2014 609-49754-431990 6/6/14 utx - Ausco Design - (10) safety vests "MCC STAFF" on back (1/2) 50.00 06/15/2014 226-45127-421980 6/6/14 utx - Ausco Design - (10) safety vests "MCC STAFF" on back (1/2) 50.00 06/15/2014 226-45127-421981 6/6/14 Walmart - (1) calculator; (2) memo book; (2) papermate 12.53 06/15/2014 226-45122-420990 6/6/14 Walmart - (1) wall clock; (1) time piece 23.35 06/15/2014 226-45122-421990 6/6/14 Walmart - re-sale 10.04 06/15/2014 226-45127-425410 6/6/14 MN Recreation & Park Assoc - 5/16/14 Beyond Accessibility-K.B. 25.00 06/15/2014 226-45122-433200 6/6/14 MN Recreation & Park Assoc - Summer Leadership Workshop-T.D. 30.00 06/15/2014 226-45122-433200 6/6/14 MN Recreation & Park Assoc-Summer Leadership Workshop-M.J.; A.E. 60.00 06/15/2014 226-45122-433200 6/6/14 Speirit Comm - C.A.L.E.A. 5/1-5/31/14 656.37 06/15/2014 655-49870-431970 6/6/14 utx - Koehler & Dramm - (60) 25 bx votives - 2014 wedding season 1,125.00 06/15/2014 226-45127-420750 6/6/14 Walmart - re-sale 14.92 06/15/2014 226-45127-425410 6/6/14 Walmart - (1) snack bags; (2) storage 11.78 06/15/2014 226-45127-421780 6/6/14 Walmart - (1) indexes; (2) 5 tab div 2.47 06/15/2014 226-45122-420990 6/6/14 Walmart - FriendshipIsland - (2) 24ct sw clk 6.35 06/15/2014 226-45127-421981 6/6/14 Walmart - (2) pitcher 6.99 06/15/2014 226-45127-421450 6/6/14 Walmart - Comm Garden - (4) 10ct staples 7.99 06/15/2014 226-45127-421980 6/6/14 Home Depot -(1) 15' glow rod set; (4) bit; (1) 29pc bit set; ect 128.59 06/15/2014 656-49877-421990 6/6/14 Cub - re-sale 36.43 06/15/2014 609-49750-425500 6/6/14 Cub - re-sale 38.84 06/15/2014 609-49750-425500 6/6/14 Cub - re-sale 23.59 06/15/2014 609-49750-425500 6/6/14 Auto Value Monticello - #105 (2) gal urethane; primer; ect. 599.74 06/15/2014 101-43120-422110 6/6/14 Auto Value Monticello - #105 sealer; activator 107.98 06/15/2014 101-43120-422110 6/6/14 Fastenal - (100) 14.5" HD blk cable T 5.09 06/15/2014 101-45201-421990 6/6/14 Gradys - #105 (1) 20x50 film poly clear 4mil 45.99 06/15/2014 101-43120-422110 6/6/14 Gradys - Router - 16 ft strap tiedown+rachet 13.99 06/15/2014 101-43120-422100 6/6/14 Walmart - re-sale 2.75 06/15/2014 226-45127-425410 AP-Computer Check Proof List by Vendor (06/18/2014 - 2:08 PM)Page 2 Invoice No Description Amount Payment Date Acct Number Reference 6/6/14 Walmart - (5) cupcake 30.00 06/15/2014 226-45127-421460 6/6/14 Walmart - (4) latch totes - toy storage in childcare 83.23 06/15/2014 226-45122-421990 6/6/14 Wright Henn Elec - Apr HADCO lights @ East 7th St 357.75 06/15/2014 101-43160-431900 6/6/14 Walmart - re-sale 13.80 06/15/2014 226-45203-425410 6/6/14 Holiday - (28.419) gallons unit #2 D.S. 99.44 06/15/2014 655-49870-421200 6/6/14 SuperAm - (28.312) gallons unit #1 B.N. 99.35 06/15/2014 655-49870-421200 6/6/14 Monticello NAPA - Stock-(2) Napagold (300) fil 1358 12.70 06/15/2014 101-43127-422120 6/6/14 Monticello NAPA - E1 gen set - (2) bulb 1.98 06/15/2014 101-42200-422110 6/6/14 USPS - First-class parcel 7 oz- flouride state sample 3.04 06/15/2014 601-49440-432200 6/6/14 Home Depot - (5) Pl 400 subfloor 28oz VOC (1/2) 11.75 06/15/2014 601-49440-422300 6/6/14 Home Depot - (5) Pl 400 subfloor 28oz VOC (1/2) 11.75 06/15/2014 602-49490-421990 6/6/14 Home Depot - (3) gl Deck Over 104.82 06/15/2014 101-45201-421510 6/6/14 Home Depot - (2) 2x10-8ft #2/BTR Doug Fir 15.58 06/15/2014 101-45201-421990 6/6/14 Home Depot - (3) gal Deck Over 104.82 06/15/2014 101-45201-421510 6/6/14 Home Depot - (12) low voltage Old Work 1g; (1) 9" pliers 50.84 06/15/2014 656-49877-421990 6/6/14 General Rental - Crack filling-(100) lbs propane fill 82.44 06/15/2014 101-43120-421990 6/6/14 General Rental - Acetylene WS tank 74.50 06/15/2014 101-43127-421520 6/6/14 Marties Farm Serv - (1) ton 18-0-8 W Slo/Rel 556.00 06/15/2014 101-45201-421600 6/6/14 Marties Farm Serv - (1) ton 18-0-8 W Slo/Rel 556.00 06/15/2014 101-45201-421600 6/6/14 Menards - (20) 2x6-12' AC2 treated; (25) 2x10-12' #2 Fir 455.40 06/15/2014 101-45201-421650 6/6/14 Wall Street Journal - monthly subscription 26.99 06/15/2014 101-41520-443300 6/6/14 OfficeMax - (2) 24x36 signs laminated 28.86 06/15/2014 226-45127-421780 6/6/14 Advanced Disposal - April 2014 31,526.95 06/15/2014 101-43230-431000 6/6/14 Advanced Disposal - April 2014 10,525.23 06/15/2014 101-43230-431010 6/6/14 Advanced Disposal - April 2014 102.81 06/15/2014 655-49870-431000 6/6/14 Advanced Disposal - April 2014 34.34 06/15/2014 655-49870-431010 6/6/14 Advanced Disposal - April 2014 65.05 06/15/2014 101-43127-431000 6/6/14 Advanced Disposal - April 2014 95.48 06/15/2014 101-45201-431000 6/6/14 Advanced Disposal - April 2014 113.39 06/15/2014 602-49480-431000 6/6/14 Advanced Disposal - April 2014 247.48 06/15/2014 226-45122-431000 6/6/14 Advanced Disposal - April 2014 11.93 06/15/2014 101-45501-431990 6/6/14 Advanced Disposal - April 2014 23.87 06/15/2014 609-49754-431000 6/6/14 Advanced Disposal - MGFARM - April 2014 10.55 06/15/2014 213-46522-431000 6/6/14 Life Fitness - (1) Upright bike - replacement 1,590.22 06/15/2014 226-45127-424900 6/6/14 Sunray Printing - (4600) Spring/Summary newsletter 2,669.66 06/15/2014 101-41940-431950 6/6/14 utx - Gradys - (10) Yale keyblank - employee breakrm; lockers 19.90 06/15/2014 226-45122-422990 6/6/14 Batteries + Bulbs - (1) 6V Lead - panic buttom battery 9.57 06/15/2014 226-45122-422990 6/6/14 Batteries + Bulbs - (1) 12V 5AH AGM - panic buttom battery 15.49 06/15/2014 101-41940-421990 6/6/14 NBP - inv 712938-0 I1) bx Splenda; (2) ct suckers 178.33 06/15/2014 609-49754-443990 6/6/14 NBP - inv 712938-0 (1) pk tape 4.01 06/15/2014 609-49754-421990 6/6/14 utx - Hirshfields - (1) 5gal paint; (1) pole sander; ect. 171.22 06/15/2014 226-45122-422990 6/6/14 NBP - inv 713297-0 (10) rm copy paper 35.80 06/15/2014 226-45122-420300 6/6/14 Chatters - ZZZNEP - 5/16/14 REP meeting - R.H. lunch 11.76 06/15/2014 101-42500-433100 AP-Computer Check Proof List by Vendor (06/18/2014 - 2:08 PM)Page 3 Invoice No Description Amount Payment Date Acct Number Reference 6/6/14 Fastenal - (50) 1/4-20x1/2 SSS CPS/S - flag pole brackets 7.07 06/15/2014 101-43120-422600 6/6/14 Monticello NAPA - Purchased 5/8/14 #226 & #228 - (1) hydo oil -51.84 06/15/2014 101-45201-422100 6/6/14 Monticello NAPA - (4) B U lamp LIT 40244 8.19 06/15/2014 602-49490-422110 6/6/14 utx - Verizon Wireless - 320-241-3917; 763-688-5387 4/21-5/20/14 61.03 06/15/2014 655-49870-432100 6/6/14 Verizon Wireless - 763-688-5936 4/21-5/20/14 26.02 06/15/2014 101-43115-432100 6/6/14 Verizon Wireless - 763-954-1070 4/21-5/20/14 26.04 06/15/2014 101-43120-432100 6/6/14 Corporate Connection - (36) Lime Class 2 t-shirt 430.20 06/15/2014 101-45201-420650 6/6/14 Corporate Connection - (30) Lime Class 2 t-shirt 358.50 06/15/2014 101-43120-420650 6/6/14 Corporate Connection - (20) Lime Class 2 t-shirt (1/2) 119.50 06/15/2014 601-49440-420650 6/6/14 Environmental Equipmt - #132 (1) Urethane Trans Assy w/seal 600 616.65 06/15/2014 101-43120-422100 6/6/14 OSC Oxygen Serv Co - assorted welding supplies 188.70 06/15/2014 101-43127-421520 6/6/14 Amazon - (2) Magicard ribbon - 250 prints 156.00 06/15/2014 101-41940-420990 6/6/14 AmeriPride - inv(s) 2200504539; 07201; 09866 - uniform rental 54.75 06/15/2014 226-45122-441700 6/6/14 AmeriPride - inv(s) 2200504539; 07201; 09866 - laundry services 209.82 06/15/2014 226-45122-431110 6/6/14 AmeriPride - inv(s) 2200504539; 07201; 09866 - towel rental 61.14 06/15/2014 226-45122-441710 6/6/14 Aramark - (6) inv(s) uniform rental 150.23 06/15/2014 101-45201-441700 6/6/14 Aramark - (6) inv(s) uniform rental 68.01 06/15/2014 602-49490-441700 6/6/14 Aramark - (6) inv(s) uniform rental 68.01 06/15/2014 601-49440-441700 6/6/14 Aramark - (6) inv(s) uniform rental 214.94 06/15/2014 101-43120-441700 6/6/14 Aramark - (6) inv(s) - uniform rental 151.72 06/15/2014 101-43127-421990 6/6/14 Corporate Connection - (20) Lime Class 2 t-shirt (1/2) 119.50 06/15/2014 602-49490-420650 6/6/14 Spectrum Supply - facility cleaning supplies 629.75 06/15/2014 226-45122-421100 6/6/14 Spectrum Supply - locker room supplies 791.72 06/15/2014 226-45122-421990 6/6/14 Spectrum Supply - foam cups; plates 53.30 06/15/2014 226-45127-425410 6/6/14 Spectrum Supply - (1) cs 8" roll towel 93.70 06/15/2014 101-45501-421990 6/6/14 Spectrum Supply - (1) cs liners 43.57 06/15/2014 101-41941-421990 6/6/14 Spectrum Supply - (4) mats; locker room supplies 388.18 06/15/2014 226-45122-421990 6/6/14 Spectrum Supply - (20) cold compress 28.64 06/15/2014 226-45203-421450 6/6/14 Spectrum Supply - facility cleaning supplies 406.25 06/15/2014 226-45122-421100 6/6/14 Spectrum Supply - food trays; cups; lids 104.86 06/15/2014 226-45203-425410 6/6/14 Spectrum Supply - disp gloves; cups; lids 117.07 06/15/2014 226-45127-425410 6/6/14 G & K Services - inv 1043710258 60.00 06/15/2014 217-41990-431990 6/6/14 Ausco Design & Mktg - (49) staff shirts w/ logo screen print 320.10 06/15/2014 226-45122-421110 6/6/14 NBP - inv 713192-1 (3) surge suppressor 180.00 06/15/2014 101-41940-420990 6/6/14 NBP - inv 713192-0 - (10) rm paper blu 45.90 06/15/2014 101-41940-420300 6/6/14 NBP - inv 713192-0 - (3) pk 3x3 not pad; post-its; ect. 108.69 06/15/2014 101-41940-420990 6/6/14 utx - Verizon Wireless - 4/4-5/3/14 123.02 06/15/2014 226-45122-432100 6/6/14 Verizon Wireless - 4/4-5/3/14 2.52 06/15/2014 226-45122-432100 6/6/14 utx - Verizon Wireless - 4/4-5/3/14 198.40 06/15/2014 655-49870-432100 6/6/14 NCH dba Dyna - shop supplies 157.00 06/15/2014 101-43127-421990 6/6/14 NCH dba Dyna - sign repair supplies 556.26 06/15/2014 101-43120-422600 6/6/14 NCH dba Dyna - sign repair supplies 73.47 06/15/2014 101-43120-422600 6/6/14 Westside Wholesale - Cushman (2) 24x13 .00X12/6 Carlisle Ultra T 286.84 06/15/2014 101-45201-422200 AP-Computer Check Proof List by Vendor (06/18/2014 - 2:08 PM)Page 4 Invoice No Description Amount Payment Date Acct Number Reference 6/6/14 G & K Serv - inv 1043712342 floor mat cleaning 142.62 06/15/2014 609-49754-431990 6/6/14 Nextel - 4/13-5/12/14 29.04 06/15/2014 101-43111-432100 6/6/14 Nextel - 4/13-5/12/14 29.04 06/15/2014 601-49440-432100 6/6/14 Nextel - 4/13-5/12/14 29.04 06/15/2014 602-49490-432100 6/6/14 Nextel - 4/13-5/12/14 17.29 06/15/2014 655-49870-432100 6/6/14 utx - Nextel - 4/13-5/12/14 11.76 06/15/2014 655-49870-432100 6/6/14 DISH - 6/2-7/1/14 56.64 06/15/2014 609-49754-432500 6/6/14 Advanced Disposal - (4) address - rebill ($90 to be credited) 120.00 06/15/2014 101-43230-431000 6/6/14 Verizon Wireless - 4/4-5/3/14 56.09 06/15/2014 101-45201-432100 6/6/14 Verizon Wireless - 4/4-5/3/14 104.49 06/15/2014 101-43120-432100 6/6/14 Verizon Wireless - 4/4-5/3/14 (1/2) 76.79 06/15/2014 601-49440-432100 6/6/14 Verizon Wireless - 4/4-5/3/14 (1/2) 76.80 06/15/2014 602-49490-432100 6/6/14 Red's - fuel for fire truck - Al G. 24.07 06/15/2014 101-42200-421200 6/6/14 Runnings - Eng1 generator-(6) g LP tank w/guage; ect. 72.47 06/15/2014 101-42200-422100 6/6/14 Delegard Tool - (1) 1/2" TIT impact wrench; ect. 270.96 06/15/2014 101-43127-421990 6/6/14 Delegard Tool - (3) 47pc 3/8DR set 6PT 153.48 06/15/2014 101-45201-421990 6/6/14 Monticello Vacuum Cleaner - (3) sets brushes 35.85 06/15/2014 101-45501-422990 6/6/14 Spectrum Supply - lids; dsp pl glove; t-spoons; plates; ect. 136.33 06/15/2014 226-45127-425410 6/6/14 utx - Spectrum Supply - (20) 30-100K cold compress 6"x9" 26.80 06/15/2014 226-45203-421450 6/6/14 utx - Spectrum Supply - (1) cs 36/100ct Kleenex 49.81 06/15/2014 226-45122-421990 6/6/14 Spectrum Supply - locker room supplies 147.58 06/15/2014 226-45122-421990 6/6/14 Spectrum Supply - cleaning supplies 424.70 06/15/2014 226-45122-421100 6/6/14 Hilton Garden Inn - 5/18-5/21/14 GFOA Conf - A.M. 574.95 06/15/2014 101-41520-433100 6/6/14 Husky Spring - #105-(2) leaf spring; (8) saddle bolt; (2) pin 758.15 06/15/2014 101-43120-422100 6/6/14 Husky Spring - #105 - refund of sales tax -48.77 06/15/2014 101-43120-422100 6/6/14 Verizon Wireless - 4/4-5/3/14 100.88 06/15/2014 101-42400-432100 6/6/14 Verizon Wireless - 4/4-5/3/14 31.05 06/15/2014 101-43115-432100 6/6/14 Verizon Wireless - 4/4-5/3/14 3.36 06/15/2014 655-49870-432100 6/6/14 MAC Tools - (1( 3-pc universal pliers set 105.00 06/15/2014 101-43127-421990 6/6/14 Marties - (15) flats; (10) grass (Median planting-Cargill donatn 452.00 06/15/2014 101-43120-422500 6/6/14 Tavern at Wild Marsh - 5/22/14 Admin meeting - J.O. 15.19 06/15/2014 101-41310-443990 6/6/14 DISH - Sirus music (monthly charge) 80.16 06/15/2014 226-45122-432500 6/6/14 Home Depot - (2) 3" Dewalt bit ti hldr; (1) 5" Husky knife; ect. 15.97 06/15/2014 656-49877-421990 6/6/14 Home Depot - chain lube for gate - (4) WD-40 23.38 06/15/2014 655-49870-422990 6/6/14 Monticello NAPA - net retn/purchase Super HC Ind -0.32 06/15/2014 101-43120-422100 6/6/14 Monticello NAPA - #223 Toro (1) hydraulic fil 1456 30.02 06/15/2014 101-45201-422100 6/6/14 Holiday - (12.585) gal unit 3 B.W. 43.53 06/15/2014 655-49870-421200 6/6/14 OfficeMax - ship 511 switch gear - FDX Priority 10 30 67.84 06/15/2014 655-49870-432200 6/6/14 Gradys - irrigation shed - (1) padlock; irrigation supplies 31.97 06/15/2014 101-45201-422510 6/6/14 Fastenal - #105 - repair parts 10.69 06/15/2014 101-43120-422110 6/6/14 Auto Value Monticello - (1) P95/oganic vapor 17.99 06/15/2014 101-45201-420650 6/6/14 Spectrum Supply - credit sale tax inv 241446 -8.58 06/15/2014 226-45203-425410 6/6/14 NBP - inv 711398-0 (1) pk paper ltr 65# yel 13.42 06/15/2014 226-45122-420300 AP-Computer Check Proof List by Vendor (06/18/2014 - 2:08 PM)Page 5 Invoice No Description Amount Payment Date Acct Number Reference 6/6/14 O Reillys - (1) Gen-set starting battery 97.84 06/15/2014 101-42200-422990 6/6/14 Dan & Jerry's Garden Ctr - Chamber flowers 62.34 06/15/2014 101-45201-440900 6/6/14 Microsoft Store Direct - Windows update for on-call remoting 96.13 06/15/2014 655-49870-421990 6/6/14 WS Darley - (3) assorted ADAP 314.38 06/15/2014 101-42200-422100 6/6/14 Morries Bufffalo Ford - #229 2014 F550 (1) digifit mats; ect. 259.93 06/15/2014 101-45201-421990 6/6/14 Trueman Welters - TC-33 tractor (1) brake cable 167.50 06/15/2014 101-45201-422100 6/6/14 utx - Belson Outdoors - (3) Classico-bronze cigarette cans 637.42 06/15/2014 226-45122-421990 6/6/14 Cub - re-sale 41.68 06/15/2014 609-49750-425500 6/6/14 Cub - re-sale 13.38 06/15/2014 609-49750-425500 6/6/14 Cub - re-sale 37.83 06/15/2014 609-49750-425500 6/6/14 NBP - (1) pk lgl paper pad; (1) pk 3x3 pad note 55.55 06/15/2014 609-49754-420990 6/6/14 NBP - (2) bx nit blu food glove 57.69 06/15/2014 609-49754-421990 6/6/14 NBP - inv 714515-1 (1) ct each gal AJAX; Pine-Sol 100.49 06/15/2014 609-49754-421100 6/6/14 utx - Dan & Jerry's Garden Ctr - flowers in pot by flag pole 18.99 06/15/2014 651-49010-421990 6/6/14 Wright Henn Elec - (14) lights 4489 School Blvd 193.90 06/15/2014 101-43160-431900 6/6/14 Wright Henn Elec - 4/16-5/15/14 (30) lights 4489 School Blvd 415.50 06/15/2014 101-43160-431900 6/6/14 Wright Henn Elec - 4/16-5/15/14 (9) lights 7th St & Highland 90.00 06/15/2014 101-43160-431900 6/6/14 Wright Henn Elec - 4/16-5/15/14 Cedar St Dundas to Chelsea 124.65 06/15/2014 101-43160-431900 6/6/14 Wright Henn Elec - 4/16-5/15/14 Chelsea Rd E 180.00 06/15/2014 101-43160-431900 6/6/14 Wright Henn Elec - 4/16-5/15/14 School Blvd Fenning/18/Edmon 372.00 06/15/2014 101-43160-431900 6/6/14 Gradys - (1) connector armored vinl 20A 9.49 06/15/2014 101-42200-422990 6/6/14 Runnings - (2) hitch pin 7/8"x4 1/4" forged 9.98 06/15/2014 101-45201-422100 6/6/14 Home Depot - (1) brass ftg; (1) 3/4" FP ball&waste; ect. 19.49 06/15/2014 601-49440-421990 6/6/14 Cub - Safety Bingo prize-(1) gift certificate 30.00 06/15/2014 101-41800-443990 6/6/14 Runnings - (2) WebDri hooded jacket 76.98 06/15/2014 602-49490-420650 6/6/14 General Rental - Crack fill - 100lb propane fill 82.44 06/15/2014 101-43120-421990 6/6/14 Marties Farm Serv - 12C009 Well #4 - 50lb grass seed 96.00 06/15/2014 601-49440-421990 6/6/14 AmeriPride - inv(s) 2200515181; 512498 - uniform rental 36.50 06/15/2014 226-45122-441700 6/6/14 AmeriPride - inv(s) 2200515181; 512498 - laundry services 139.88 06/15/2014 226-45122-431110 6/6/14 AmeriPride - inv(s) 2200515181; 512498 - towel rental 40.76 06/15/2014 226-45122-441710 6/6/14 Home Depot - SCBA - assorted batteries 221.44 06/15/2014 101-42200-422990 6/6/14 Marties Farm Serv - (4) 6.8# Quick Pro-Dry 448.50 06/15/2014 101-45201-421600 6/6/14 Moon Motorsports - (1) HD Hero3 Black Plus; 64GB Action Micro S 449.95 06/15/2014 101-41520-421990 6/6/14 Marties Farm Serv - (1) ton 18-0-8 w/slow release 556.00 06/15/2014 101-45201-421600 6/6/14 Marties Farm Serv - (1) ton 18-0-8 w/slow release 556.00 06/15/2014 101-45201-421600 6/6/14 Marties Farm Serv - (1) ton 18-0-8 w/slow release 556.00 06/15/2014 101-45201-421600 6/6/14 Monticello NAPA - Jaws of Life-(1) fitting 6.48 06/15/2014 101-42200-422100 6/6/14 Monticello NAPA - (24) NOL 75130 83.28 06/15/2014 602-49490-421300 6/6/14 SuperAm - (28.093) gallons unti 1 B.N. 98.30 06/15/2014 655-49870-421200 6/6/14 Auto Value Monticello -#105 (4) Ful-Cryl acrlic; (1) sealer; ect 232.91 06/15/2014 101-43120-422100 6/6/14 Auto Value Monticello -#148 - net purchase/retn (1) Starter-RMFD 38.99 06/15/2014 101-43120-422100 6/6/14 Amazon - HR printer - (1) 2200 Jumbo toner 60.71 06/15/2014 101-41940-420990 6/6/14 Home Depot - (10) 1 Schedule 40x10'; (3) 1" conduit; ect. 49.78 06/15/2014 656-49877-421990 AP-Computer Check Proof List by Vendor (06/18/2014 - 2:08 PM)Page 6 Invoice No Description Amount Payment Date Acct Number Reference 6/6/14 Cub - re-sale 32.90 06/15/2014 609-49750-425500 6/6/14 Moon Motorsports - (12) Stihl 2.6 HP Premix P/N 9320 28.68 06/15/2014 101-43127-421300 6/6/14 Gradys - (3) coupling insert poly 1 1/4" 2.97 06/15/2014 101-45201-422510 6/6/14 Gradys - (1) semi-desk top calculator (1/2) 6.50 06/15/2014 601-49440-421990 6/6/14 Gradys - (1) semi-desk top calculator (1/2) 6.49 06/15/2014 602-49490-421990 6/6/14 Gradys - 12C008 - (1) conduit splice 1/2" SCH40 PVC couple comp 3.99 06/15/2014 400-43300-459010 6/6/14 Gradys - (1) 4pk 1 1/4" alligator clip 2.79 06/15/2014 602-49490-421990 6/6/14 Holiday - (1) sunscreen - Ban Boat Sport (while crack filling 10.68 06/15/2014 101-43120-420650 6/6/14 Monticello NAPA - (2) retainer (533) BK 665-2342 11.52 06/15/2014 101-45201-422510 6/6/14 USPS - state reports - 2.30oz First-Class mail large env 16.23 06/15/2014 217-41990-432200 6/6/14 Runnings - sprayer parts - (2) nylon cap; (1) 4pk flat tip 27.97 06/15/2014 101-45201-422100 6/6/14 Runnings - Welding gloves - (1) pr deluxe; (1) pr lined 23.88 06/15/2014 101-43127-420650 6/6/14 O Ryans - Kawi Mule - (5.388) gallons non-ox D.W. 21.01 06/15/2014 101-45201-421200 6/6/14 SuperAm - (8.435) gallons G.D. 29.77 06/15/2014 217-41990-421200 6/6/14 NBP - (12) rl add tape 16.00 06/15/2014 217-41990-420990 6/6/14 OfficeMax - monitor riser; paper/binder clips; white out; ect. 57.37 06/15/2014 655-49870-420990 6/6/14 MAC Tools - (1) 8" double jaw cable shear 69.99 06/15/2014 601-49440-421990 6/6/14 MAC Tools - (1) 1/4" mini die grinder 72.74 06/15/2014 101-43127-421990 6/6/14 Royal Tire - (1)13.6/14.9R-28/30 TR218A; (1) fram-imp MT/DMT 88.27 06/15/2014 101-45201-422200 6/6/14 Monticello NAPA - stock- assorted fuel; air & oil filters 197.52 06/15/2014 101-43127-422120 6/6/14 Marties Farm Serv - (1) ton 18-0-8 w/slow release 556.00 06/15/2014 101-45201-421600 6/6/14 Home Depot - rtn (6) studs (warehouse project MCC)-22.62 06/15/2014 226-45122-422300 6/6/14 Delegard Tool - (1) 3/8 dr skt rail not shipped w/original order -1.93 06/15/2014 101-43127-421990 6/6/14 Zee Medical Serv - (3) glove dispenser; First Aid supplies 328.45 06/15/2014 101-43127-420650 6/6/14 Arctic Glacier - re-sale (4) invoices 901.21 06/15/2014 609-49750-425500 6/6/14 M-R Sign Co Inc - (10) No Truck Parking...; (10) No Parking... 1,247.56 06/15/2014 101-43120-422600 6/6/14 utx - Beacon Athletics-(1) 4-wheel line chalker; (12) plug 561.31 06/15/2014 101-45203-421990 6/6/14 Dollar Tree Stores - Walk N Roll - (2) rubber ducks 2.14 06/15/2014 217-41990-443990 6/6/14 utx - Fastenal - (1) pocket tool pouch 5.20 06/15/2014 656-49877-421990 6/6/14 Jimmy Johns - 6/3/14 (5) lunchs (A.S. reimbursed city) 43.41 06/15/2014 101-00000-115030 6/6/14 Moon Motorsports - (1) filler cap 8.25 06/15/2014 101-43120-422100 6/6/14 Gradys - (1) 3G metal tripoxy sprayer for deisel 49.99 06/15/2014 101-43127-421990 6/6/14 Home Depot - Hunters Crossing mailboxes - (2) 2x6-8 cedar 27.12 06/15/2014 101-43120-422500 6/6/14 Home Depot - (21) steel post-mount mailbox (tax to be refunded) 403.31 06/15/2014 101-43120-422500 6/6/14 Dyna - hoses; washers; cable ties; fuses 271.43 06/15/2014 101-43127-421990 6/6/14 Taget - safety incentive prizes 190.60 06/15/2014 101-41800-443990 6/6/14 DQ - National Safety Month prizes 70.00 06/15/2014 101-41800-443990 6/6/14 NBP - inv 719103-0 (2) bookrack 148.00 06/15/2014 101-41940-420990 6/6/14 NBP - inv 719103-0 (3) box Ibuprofen 41.97 06/15/2014 101-41940-443990 6/6/14 NBP - inv 716777 (8) bx hanging folders; file folders; ect. 686.48 06/15/2014 655-49870-420990 6/6/14 Auto Value Monticello - small engine oil - (12) HD 30 oil 41.88 06/15/2014 101-45201-421300 6/6/14 Auto Value Monticello - (1) P95/organic vafor - PPE spraying 16.49 06/15/2014 101-45201-420650 6/6/14 Gradys - (1) 4" cap PVC/DWV SCH40 8.49 06/15/2014 602-49490-422700 AP-Computer Check Proof List by Vendor (06/18/2014 - 2:08 PM)Page 7 Invoice No Description Amount Payment Date Acct Number Reference 6/6/14 Gradys - (2) 60lb Quikrete; (1) 4x4 couple flex cast 21.97 06/15/2014 602-49490-422700 6/6/14 NBP - inv 719103-1 (5) 100 pk wht VDO GRD PVC card 98.43 06/15/2014 101-41940-420990 6/6/14 utx - Burnhams - (3) yd red mulch 75.00 06/15/2014 226-45122-422500 6/6/14 Midway Iron - #105 (1) 20' flat 3/8x3; (1) 4-5/8"x8' smth plate 94.98 06/15/2014 101-43120-422100 6/6/14 ZZBCOL - Midway Iron - Pier - (1) 12' round bar 3/4 SS304 49.80 06/15/2014 229-45202-453010 6/6/14 Monticello NAPA - truck shut-off (2) harness; (2) fittings; ect. 23.76 06/15/2014 101-42200-422110 6/6/14 Monticello NAPA - stock - gas line (25) fuel line hose 27.25 06/15/2014 101-43127-422110 6/6/14 utx - Monoprice Inc - H.E. cameras - (1) HDMI extender cable 27.77 06/15/2014 655-49870-421990 6/6/14 Hi-Way Liquors - (7) 2 liter Diet Coke (MCC port bar broken) 18.63 06/15/2014 226-45127-425410 6/6/14 Target - re-sale 74.69 06/15/2014 226-45127-425410 6/6/14 Dollar Tree - Friendship Island - decorations; (4) chalk 12.83 06/15/2014 226-45127-421981 6/6/14 Cub - Farmer's Mkt - (7) lemonade - re-sale 6.23 06/15/2014 226-45127-425410 6/6/14 Cub - (1) Dawn 3.94 06/15/2014 226-45122-421100 6/6/14 Cub - re-sale 17.21 06/15/2014 226-45127-421450 6/6/14 NBP - inv 717176-0 (2) rm grn paper 13.42 06/15/2014 226-45122-420300 6/6/14 Constant Contact - monthly email program use fee 50.00 06/15/2014 226-45122-430920 6/6/14 Cub - re-sale 90.84 06/15/2014 226-45127-425410 6/6/14 Kwik Trip - (28.995) gallons unit 2 D.S. 102.32 06/15/2014 655-49870-421200 6/6/14 Walmart - Climbing wall (8) duct tape 28.81 06/15/2014 226-45127-421710 6/6/14 Walmart - (6) assorted insect repellent 51.75 06/15/2014 226-45203-421450 6/6/14 Walmart - (7) pk assorted pins 24.89 06/15/2014 226-45127-420750 6/6/14 Walmart - re-sale 30.88 06/15/2014 226-45127-425410 6/6/14 US Bank Rebate Q1 2014 -1,515.84 06/15/2014 101-00000-362970 6/6/14 US Bank Rebate Q1 2014 -73.09 06/15/2014 101-42200-362970 6/6/14 US Bank Rebate Q1 2014 -109.49 06/15/2014 101-43120-362970 6/6/14 US Bank Rebate Q1 2014 -69.37 06/15/2014 101-43125-362970 6/6/14 US Bank Rebate Q1 2014 -37.33 06/15/2014 101-43127-362970 6/6/14 US Bank Rebate Q1 2014 -49.38 06/15/2014 101-43160-362970 6/6/14 US Bank Rebate Q1 2014 -65.17 06/15/2014 101-45201-362970 6/6/14 US Bank Rebate Q1 2014 -7.74 06/15/2014 101-45203-362970 6/6/14 US Bank Rebate Q1 2014 -0.68 06/15/2014 213-00000-362970 6/6/14 US Bank Rebate Q1 2014 -20.74 06/15/2014 217-41990-362970 6/6/14 US Bank Rebate Q1 2014 -2.20 06/15/2014 224-46102-362970 6/6/14 US Bank Rebate Q1 2014 -348.05 06/15/2014 226-45122-362970 6/6/14 US Bank Rebate Q1 2014 -49.74 06/15/2014 226-45127-362970 6/6/14 US Bank Rebate Q1 2014 -104.24 06/15/2014 601-49440-362970 6/6/14 US Bank Rebate Q1 2014 -54.78 06/15/2014 602-49480-362970 6/6/14 US Bank Rebate Q1 2014 -23.09 06/15/2014 602-49490-362970 6/6/14 US Bank Rebate Q1 2014 -63.38 06/15/2014 609-49750-362970 6/6/14 US Bank Rebate Q1 2014 -68.78 06/15/2014 655-00000-362970 6/6/14 US Bank Rebate Q1 2014 -33.52 06/15/2014 656-49877-362970 6/6/14 utx - Sonora Design Assoc - (1) HD24AL-T 82.00 06/15/2014 655-49870-421990 6/6/14 utx - Google apps - calendar app 70.00 06/15/2014 655-49870-421990 AP-Computer Check Proof List by Vendor (06/18/2014 - 2:08 PM)Page 8 Invoice No Description Amount Payment Date Acct Number Reference 6/6/14 MTI - Toro HC 4000 - (30) tine-side eject 150.60 06/15/2014 101-45201-422100 6/6/14 utx - Gradys - screws 2.98 06/15/2014 226-45122-422990 6/6/14 Paypal - Speed trailer - (4) 128mb memory card 17.25 06/15/2014 101-43120-421990 6/6/14 Gradys - (3) 50lb Fastset red concrete mix 33.63 06/15/2014 101-43120-421990 6/6/14 US Foods Culinary E & S - (1) 1000 watt microwave 423.94 06/15/2014 226-45203-421450 6/6/14 Rhomar Ind - (5) 5-gal Rhoma-Sol asphalt & tack oil emulsifier 228.02 06/15/2014 101-43127-421600 6/6/14 Fastenal - ZZBCOL - (50) each .5 galv keg; nut; 1/2 L/W 42.26 06/15/2014 101-45201-421990 6/6/14 Midway Iron - ZZBCOL - (2) 24' PI SCH40 4" galv SOPI4GS40 512.82 06/15/2014 229-45202-453010 6/6/14 SuperAm - fuel 26.62 06/15/2014 217-41990-421200 6/6/14 NBP - inv 719530-0 (20) rm copy paper 67.00 06/15/2014 217-41990-420300 6/6/14 NBP - inv 719530-0 (1) print calculator; (6) 28qt recycle bin 201.64 06/15/2014 217-41990-420990 6/6/14 NBP - inv 716640-0 (6) pen; (1) bx staples; (1) pk Magic tape 50.05 06/15/2014 217-41990-420990 6/6/14 NBP - inv 713297-1 (1) 25 pkt blk time card rack 26.44 06/15/2014 226-45122-420990 6/6/14 Central Landscape - (3) 4' Black Hills Spruce (tax to be credit) 306.02 06/15/2014 101-43120-422500 6/6/14 Applied MSS - (1) 12 pk each red iron & lt gray oxide primer 178.60 06/15/2014 101-43127-421510 6/6/14 Safety Kleen - (8) g waste combustible liquid 171.69 06/15/2014 101-43127-431990 6/6/14 Marties Farm Serv - Adopt-A-Park 1,845.82 06/15/2014 101-45201-440900 6/6/14 Norcostco - (4) Rosco clear fog fluid for SCBA rescue training 239.80 06/15/2014 101-42200-421990 6/6/14 WS Darley Co - (1) USAR mission back pack 114.95 06/15/2014 101-42200-421990 6/6/14 WS Darley Co - (10) extrication glove; (4) Nomex blend hood; ect 696.88 06/15/2014 101-42200-421990 6/6/14 Gradys - (1) conduit PVC SCH 40 1/2" 2.29 06/15/2014 101-45201-422300 6/6/14 Olson & Sons Elec - (1) 100W clr MOG 38.01 06/15/2014 101-45201-422300 6/6/14 Marties Farm Serv - (2) 4-6-4 Organic 58.00 06/15/2014 101-45201-421600 6/6/14 General Rental - Crack fill - 100 lb propane fill 82.44 06/15/2014 101-43120-421990 6/6/14 utx -Amazon.com - (1) Ubiquiti Networks UniFi AC Ent WiFi System 302.98 06/15/2014 655-49870-421990 6/6/14 utx -Electric Motor-AC unit #5 motor condensing unit Fasco 3/4hp 245.29 06/15/2014 226-45122-440440 6/6/14 utx -Electric Motor - (2) 3JES insert-boiler circ pumps couplers 10.08 06/15/2014 226-45122-422990 6/6/14 utx -Electric Motor - H.E. Bldg A/C - 1/3hp fan Fasco motor; ect 599.00 06/15/2014 655-49870-440440 6/6/14 Biffs - 4/2-4/29/14 PW; 7 parks; ballfields 305.16 06/15/2014 101-45201-431990 6/6/14 On Call Serv Inc-Indoor play structure parts (labor still owed) 3,860.60 06/15/2014 226-45122-440800 6/6/14 Bailey Nuseries - Spring Tree order 270 (230 sold to residents) 6,807.22 06/15/2014 224-46102-421680 6/6/14 Cooters Place-fradulent trans to be credited on 7/6/14 statement 291.43 06/15/2014 101-41520-443990 6/6/14 BikeBandit-fradulent trans to be credited on 7/6/14 statement 167.90 06/15/2014 101-41520-443990 6/6/14 Onnit Labs-fradulent trans to be credited on 7/6/14 statement 445.12 06/15/2014 101-41520-443990 6/6/14 PCRichard.Com-fradulent trans to be credited on 7/6/14 statement 169.97 06/15/2014 101-41520-443990 98,571.44Check Total: Vendor:2438 VANCO SERVICES LLC Check Sequence: 4 ACH Enabled: True 00006141373 Vanco Fitness Rewards May 2014 67.50 06/15/2014 226-45122-430700 00006141891 Gateway transaction/program fees May 2014 35.70 06/15/2014 655-49870-443980 00006141891 Gateway transaction/program fees May 2014 28.85 06/15/2014 601-49440-443980 00006141891 Gateway transaction/program fees May 2014 28.85 06/15/2014 602-49490-443980 AP-Computer Check Proof List by Vendor (06/18/2014 - 2:08 PM)Page 9 Invoice No Description Amount Payment Date Acct Number Reference 160.90Check Total: Vendor:1585 XCEL ENERGY Check Sequence: 5 ACH Enabled: True 5/12/14 utx - 51-9069641-8 2,335.03 06/15/2014 655-49870-438100 5/12/14 utx - 51-9348896-7 250.02 06/15/2014 101-41940-438100 5/12/14 utx - MGFARM - 51-0592578-0 17.10 06/15/2014 213-46522-438100 5/19/14 utx - MGFARM - 51-0798481-0 46.18 06/15/2014 213-46522-438100 5/20/14 utx - 51-9391437-3 295.14 06/15/2014 101-41941-438100 5/27/14 utx - MGFARM - 51-0592578-0 6.07 06/15/2014 213-46522-438100 5/27/14 utx - MGFARM - 51-0517384-8 16.45 06/15/2014 213-46522-438100 5/28/14 51-6505907-2 90.30 06/15/2014 101-43140-438100 5/28/14 51-6505916-3 11,927.23 06/15/2014 101-43160-438100 5/29/14 51-6505905-0 5,563.38 06/15/2014 601-49440-438100 5/9/14 51-4400193-4 17.10 06/15/2014 101-43160-438100 6/10/14 51-0395766-0 798.66 06/15/2014 601-49440-438100 6/2/14 51-6505906-1 944.97 06/15/2014 602-49490-438100 6/2/14 51-6505914-1 768.50 06/15/2014 101-43127-438100 6/2/14 51-6505915-2 574.82 06/15/2014 101-45201-438100 6/2/14 51-6505915-2 112.96 06/15/2014 601-49440-438100 6/2/14 utx - 51-6505915-2 133.25 06/15/2014 226-45203-438100 6/2/14 utx - 51-6505915-2 133.38 06/15/2014 101-45203-438100 6/9/14 51-4271112-2 910.23 06/15/2014 101-45501-438100 6/9/14 51-6505911-8 2,185.02 06/15/2014 101-41940-438100 6/9/14 utx - 51-6505911-8 9,489.28 06/15/2014 226-45122-438100 6/9/14 51-6505911-8 561.87 06/15/2014 101-45175-438100 6/9/14 51-6505911-8 249.72 06/15/2014 101-42800-438100 37,426.66Check Total: Total for Check Run: Total of Number of Checks: 194,532.54 5 AP-Computer Check Proof List by Vendor (06/18/2014 - 2:08 PM)Page 10 The preceding list of bills payable was reviewed and approved for payment. Date: 6/23/14 Approved by: _____________________________________ Mayor Clint Herbst CityCouncilAgenda:6/23/14 1 5B.ConsiderationofapprovingnewhiresanddeparturesforCitydepartments (TE) A.REFERENCEANDBACKGROUND: TheCouncilisaskedtoratifythehiringanddeparturesofemployeesthathaveoccurred recentlyinthedepartmentslisted.ItisrecommendedthattheCouncilofficiallyratifythe hiring/departureofalllistedemployeesincludingpart-timeandseasonalworkers. A1.BudgetImpact:(positionsaregenerallyincludedinbudget) A2.StaffWorkLoadImpact:Ifnewpositions,theremaybesometraining involved.Ifterminatedpositions,existingstaffwouldpickupthosehours,as needed,untilreplaced. B.ALTERNATIVEACTIONS: 1.Motiontoratifythehire/departuresoftheemployeesasidentifiedontheattached list. 2.Motiontodenytherecommendedhiresanddepartures. C.RECOMMENDATION: BystatutetheCityCouncilhastheauthoritytoapproveallhires/departures.Citystaff recommendsAlternative#1,fortheCounciltoapprovethehiresand/ordeparturesas listed. D.SUPPORTINGDATA: Listofnew/terminatedemployees Name Title Department Hire Date Class Matthew Spangler Slide Attendant MCC 5/29/14 PT Andrew Carlson Locator FNM 6/18/2014 Seasonal Name Reason Department Last Day Class Samantha Murray Voluntary MCC 5/30/14 PT NEW EMPLOYEES TERMINATING EMPLOYEES New Hire and Terms City Council 2014: 6/18/2014 CouncilAgenda:06/23/14 1 5C.ConsiderationofaadoptingResolution#2014-063establishinganAbsenteeBallot Boardforthe2014Elections (CS) A.REFERENCEANDBACKGROUND: In2010,theStateLegislatureadoptedmanychangestotheabsenteevotingprocess, whichallowedmunicipalitiestoadministerabsenteevotingincludingtheprocessingof applicationsandballots.Section203B.121oftheMinnesotaStateStatutesrequiresthe CitytoestablishanAbsenteeBallotBoardbyresolution,iftheyareconductingabsentee votinginthemunicipality.ThemainfunctionoftheAbsenteeBallotBoardistoprocess andacceptorrejectabsenteeballots.Thisishandledbyappointedelectionjudgesand mustbecompletedaccordingtoelectionrules.Theabsenteeballotvotingperiodrunsfor 46dayspriortoelectiondayforboththeprimaryandgeneralelections.Absenteevoting forthePrimaryrunsfromJune27th toAugust11th,andfortheGeneralelectionfrom September19th toNovember3rd. TheDeputyCityClerkhasbeendesignatedtoserveasadministratoroftheabsentee votingprocessunderthedirectionofWrightCountyAuditor’sOffice.SeveralotherCity employeeswillhelpadministertheonlineprocessingforabsenteeballotrequests,which beginsattheendofthismonth. A1.BudgetImpact:Personnelcostsincorporatedintothe2014budget. A2.StaffImpact:TheabsenteevotingprocesswillinvolvetheDeputyCityClerk, AdministrativeAssistantandtwootheremployees.Allotherassistanceis providedbycityresidentsthatserveaselectionjudges.Appointmentofelection judgesiscoveredinaseparateagendaitem. B.ALTERNATIVEACTIONS: 1.MotiontoadoptResolution#2014-064establishinganAbsenteeBallotBoardfor the2014elections. 2.Motionofother. C.STAFFRECOMMENDATION: StaffrecommendsAlternative#1. D.SUPPORTINGDATA: Resolution#2014-063 ExcerptfromMNStateStatutes–BallotBoards CITYOFMONTICELLO WRIGHTCOUNTY,MINNESOTA RESOLUTIONNO.2014-063 ESTABLISHINGANABSENTEEBALLOTBOARD FORTHE2014ELECTIONS WHEREAS,MinnesotaStateStatutesChapter203B.121providesauthoritytoamunicipalityto establishanAbsenteeBallotBoardinaccordancewiththeprovisionsofthelaw;and WHEREAS,anAbsenteeBallotBoardwillallowelectionjudgestoperformthetaskof administeringabsenteevotingasdescribedinMinnesotaElectionLaws,starting46dayspriorto thePrimaryandGeneralelections;and WHEREAS,theCitywillhavethenecessaryequipment,trainingandotherresourcesinplaceto administerabsenteevotingasprescribedbytheMinnesotaSecretaryofState’soffice; NOWTHEREFORE,BEITHEREBYRESOLVEDBYTHEMONTICELLOCITY COUNCIL,thatanAbsenteeBallotBoardbeestablishedforthepurposeofadministeringthe absenteevotingprocess,asprovidedforbylaw. ADOPTEDBY theMonticelloCityCouncilthis23rddayofJune,2014. CITYOFMONTICELLO __________________________________________ ClintHerbst,Mayor ATTEST: _______________________________________ JeffO’Neill,CityAdministrator CERTIFICATION STATEOFMINNESOTA COUNTYOFWRIGHT IherebycertifythattheforegoingisatrueandcorrectcopyofResolution#2014-063 dulypassed,adoptedandapprovedbytheMonticelloCityCouncilattheirscheduledmeetingon June23,2014,andrecordedinminutesofsaidmeeting. ____________________________________ CatherineM.Shuman,DeputyClerk NotaryPublic:_______________________________ Date:___________________________ (STAMP) 1 MINNESOTA STATUTES 2013 203B.121 203B.121 BALLOT BOARDS. Subdivision 1.Establishment;applicable laws.(a)The governing body of each county, municipality,and school district with responsibility to accept and reject absentee ballots must,by ordinance or resolution,establish a ballot board.The board must consist of a sufficient number of election judges trained in the handling of absentee ballots and appointed as provided in sections 204B.19 to 204B.22.The board may include deputy county auditors or deputy city clerks who have received training in the processing and counting of absentee ballots. (b)Each jurisdiction must pay a reasonable compensation to each member of that jurisdiction's ballot board for services rendered during an election. (c)Except as otherwise provided by this section,all provisions of the Minnesota Election Law apply to a ballot board. Subd.2.Duties of ballot board;absentee ballots.(a)The members of the ballot board shall take possession of all return envelopes delivered to them in accordance with section 203B.08. Upon receipt from the county auditor,municipal clerk,or school district clerk,two or more members of the ballot board shall examine each return envelope and shall mark it accepted or rejected in the manner provided in this subdivision.Election judges performing the duties in this section must be of different major political parties,unless they are exempt from that requirement under section 205.075,subdivision 4,or section 205A.10,subdivision 2. (b)The members of the ballot board shall mark the return envelope "Accepted"and initial or sign the return envelope below the word "Accepted"if a majority of the members of the ballot board examining the envelope are satisfied that: (1)the voter's name and address on the return envelope are the same as the information provided on the absentee ballot application; (2)the voter signed the certification on the envelope; (3)the voter's Minnesota driver's license,state identification number,or the last four digits of the voter's Social Security number are the same as the number provided on the voter's application for ballots.If the number does not match the number as submitted on the application,or if a number was not submitted on the application,the election judges must compare the signature provided by the applicant to determine whether the ballots were returned by the same person to whom they were transmitted; (4)the voter is registered and eligible to vote in the precinct or has included a properly completed voter registration application in the return envelope; (5)the certificate has been completed as prescribed in the directions for casting an absentee ballot;and (6)the voter has not already voted at that election,either in person or,if it is after the close of business on the seventh day before the election,by absentee ballot. The return envelope from accepted ballots must be preserved and returned to the county auditor. (c)(1)If a majority of the members of the ballot board examining a return envelope find that an absentee voter has failed to meet one of the requirements provided in paragraph (b),they shall mark the return envelope "Rejected,"initial or sign it below the word "Rejected,"list the reason for the rejection on the envelope,and return it to the county auditor.There is no other Copyright ©2013 by the Office of the Revisor of Statutes,State of Minnesota.All Rights Reserved. 2 MINNESOTA STATUTES 2013 203B.121 reason for rejecting an absentee ballot beyond those permitted by this section.Failure to place the ballot within the security envelope before placing it in the outer white envelope is not a reason to reject an absentee ballot. (2)If an envelope has been rejected at least five days before the election,the envelope must remain sealed and the official in charge of the ballot board shall provide the voter with a replacement absentee ballot and return envelope in place of the rejected ballot. (3)If an envelope is rejected within five days of the election,the envelope must remain sealed and the official in charge of the ballot board must attempt to contact the voter by telephone or e-mail to notify the voter that the voter's ballot has been rejected.The official must document the attempts made to contact the voter. (d)The official in charge of the absentee ballot board must mail the voter a written notice of absentee ballot rejection between six and ten weeks following the election.If the official determines that the voter has otherwise cast a ballot in the election,no notice is required.If an absentee ballot arrives after the deadline for submission provided by this chapter,the notice must be provided between six to ten weeks after receipt of the ballot.A notice of absentee ballot rejection must contain the following information: (1)the date on which the absentee ballot was rejected or,if the ballot was received after the required deadline for submission,the date on which the ballot was received; (2)the reason for rejection;and (3)the name of the appropriate election official to whom the voter may direct further questions,along with appropriate contact information. (e)An absentee ballot return envelope marked "Rejected"may not be opened or subject to further review except in an election contest filed pursuant to chapter 209. Subd.3.Record of voting.(a)When applicable,the county auditor or municipal clerk must immediately record that a voter's absentee ballot has been accepted.After the close of business on the seventh day before the election,a voter whose record indicates that an absentee ballot has been accepted must not be permitted to cast another ballot at that election.In a state primary, general,or state special election for federal or state office,the auditor or clerk must also record this information in the statewide voter registration system. (b)The roster must be marked,and a supplemental report of absentee voters who submitted a voter registration application with their ballot must be created,no later than the start of voting on election day to indicate the voters that have already cast a ballot at the election.The roster may be marked either: (1)by the county auditor or municipal clerk before election day; (2)by the ballot board before election day;or (3)by the election judges at the polling place on election day. The record of a voter whose absentee ballot was received after the close of business on the seventh day before the election is not required to be marked on the roster or contained in a supplemental report as required by this paragraph. Subd.4.Opening of envelopes.After the close of business on the seventh day before the election,the ballots from return envelopes marked "Accepted"may be opened,duplicated as Copyright ©2013 by the Office of the Revisor of Statutes,State of Minnesota.All Rights Reserved. 3 MINNESOTA STATUTES 2013 203B.121 needed in the manner provided in section 206.86,subdivision 5,initialed by the members of the ballot board,and deposited in the appropriate ballot box.If more than one ballot is enclosed in the ballot envelope,the ballots must be returned in the manner provided by section 204C.25 for return of spoiled ballots,and may not be counted. Subd.5.Storage and counting of absentee ballots.(a)On a day on which absentee ballots are inserted into a ballot box,two members of the ballot board must: (1)remove the ballots from the ballot box at the end of the day; (2)without inspecting the ballots,ensure that the number of ballots removed from the ballot box is equal to the number of voters whose absentee ballots were accepted that day;and (3)seal and secure all voted and unvoted ballots present in that location at the end of the day. (b)After the polls have closed on election day,two members of the ballot board must count the ballots,tabulating the vote in a manner that indicates each vote of the voter and the total votes cast for each candidate or question.In state primary and state general elections,the results must indicate the total votes cast for each candidate or question in each precinct and report the vote totals tabulated for each precinct.The count must be recorded on a summary statement in substantially the same format as provided in section 204C.26.The ballot board shall submit at least one completed summary statement to the county auditor or municipal clerk.The county auditor or municipal clerk may require the ballot board to submit a sufficient number of completed summary statements to comply with the provisions of section 204C.27,or the county auditor or municipal clerk may certify reports containing the details of the ballot board summary statement to the recipients of the summary statements designated in section 204C.27. In state primary and state general elections,these vote totals shall be added to the vote totals on the summary statements of the returns for the appropriate precinct.In other elections,these vote totals may be added to the vote totals on the summary statement of returns for the appropriate precinct or may be reported as a separate total. The count shall be public.No vote totals from ballots may be made public before the close of voting on election day. (c)In addition to the requirements of paragraphs (a)and (b),if the task has not been completed previously,the members of the ballot board must verify as soon as possible,but no later than 24 hours after the end of the hours for voting,that voters whose absentee ballots arrived after the rosters were marked or supplemental reports were generated and whose ballots were accepted did not vote in person on election day.An absentee ballot submitted by a voter who has voted in person on election day must be rejected.All other accepted absentee ballots must be opened,duplicated if necessary,and counted by members of the ballot board.The vote totals from these ballots must be incorporated into the totals with the other absentee ballots and handled according to paragraph (b). History:2010 c 194 s 9;2010 c 314 s 4;2013 c 131 art 1 s 6-8;art 2 s 17,18 Copyright ©2013 by the Office of the Revisor of Statutes,State of Minnesota.All Rights Reserved. CityCouncilAgenda:06/23/14 1 5D.Considerationofappointingelectionjudgestoserveforthe2014elections,including judgesfortheAbsenteeBallotBoardandHealthCareFacilityvoting (CS) A.REFERENCEANDBACKGROUND: MinnesotaStatutesChapter204B.21requirescitiestoappointelectionjudgestoserveat primaryandgeneralelectionsandontheAbsenteeBallotBoard.AHeadElectionjudge shouldalsobedesignatedaspartoftheappointment.Theappointmentofthesejudgesis contingentuponthemcompletingthenecessarytraining,whichisrequiredeverytwo yearswithtrainingsessionstakingplaceinJuneandJuly. Wearepleasedtoreportthatwehaveabout40peoplethatindicatedaninterestinbeing anelectionjudgeandhavecompletedanapplication.Thislistincludespeoplethat signedupatcaucusesandwereprovidedtousfromtheCounty.WerequestthatCouncil approveallofthenamesonthelisttoserveaselectionjudgesfor2014.Wealsoaskthat RichardQuickbeappointedasHeadElectionJudgeforthe2014elections.Mr.Quick hasservedinthiscapacityinthepastandisveryknowledgeableoftheentireelection processandfamiliarwithmostoftheelectionjudgesthathaveservedpreviously.Alyssa Rhoades,MaryLenzen,JulieSpiers,RoseanneDuran,andRosemaryDahlwillserveas leadjudges,splittingdutiesbetweenthetwoshiftsonelectiondays.Weanticipate needingadditionaljudgesfortheGeneralelectionandarerecruitingothercandidatesto serveaselectionjudges,whichwillbepresentedforapprovalatalaterdate. Severalmembersofcitystaffwillagainbeassistingwiththeabsenteevotingprocess. Withthechangeintheabsenteevotingprocess,whichnolongerrequiresareasonfor votingpriortoelectionday,weanticipateagreaternumberofvotersthatopttovote absentee.Weareworkingonprocessestomakethisasefficientaspossible. Whenanabsenteeballotapplicationisreceived,citystaffwouldberesponsiblefor enteringtheinformationintotheelectronicStateVoterRegistrationSystem(SVRS), printingofflabels,andassemblingaballotpacket.Citystaffalsoreceivesthecompleted ballotpacketswhentheyarereturned,whicharethenturnedovertotheAbsenteeBallot Boardforapprovalorrejection,asrequiredbyelectionlaw.TherecommendedAbsentee BallotBoardjudgesarehighlightedonthelistofjudges.WerequestthatCouncil appointthesepeopleasmembersoftheAbsenteeBallotBoardforboththeprimaryand generalelections. Anotherrecentchangeinthelawistheabilityforunregisteredvoterstoregister electronicallythroughtheSecretaryofState’swebsite.Wewillbemakingthisavailable onourpubliccomputeratcityhallforresidentsthatwalkinandwishtoregistertovote. Theycanalsopickupapapervoterregistrationformatcityhall. A1.BudgetImpact:Electionjudgecompensationisincludedinthe2014budget. A2.StaffWorkloadImpact:TheDeputyClerkandAdministrativeAssistantwillbe involvedwithelectionstoagreaterdegreethanotherstaff.Asitgetsclosertothe CityCouncilAgenda:06/23/14 2 PrimaryandGeneralElectiondays,itisanticipatedthatmoretimewillbespent onelections,includingsomeovertime.ItshouldbenotedthatStateElection Lawsmandatecertainhoursforabsenteeandregularvoting,someofwhichfall outsideofregularcityworkhours. B.ALTERNATIVEACTIONS: 1.Motiontoappoint2014electionjudgesasrecommended. 2.Motionofother. C.STAFFRECOMMENDATION: CitystaffrecommendsAlternative#1.Inordertoconductelectionsinthemanner prescribedbylaw,itisrecommendedtohaveanamplesupplyofelectionjudgesandthe availabilityofcitystafftoassistasneeded.Councilsupportofthisdecisionwillhelp ensureanefficientandeffectiveelectionprocess. D.SUPPORTINGDATA: ElectionJudgeproposedappointmentsasof6/18/14 ExcerptfromMNStatutes–AppointmentofElectionJudges ELECTION JUDGES - 2014 mailed app letters 5/28/14 received as of 6/18/14 name address1 address2 city,st,zip Ahrens, Jerrie 506 Minnesota Street Monticello MN 55362 Anderson, Cindy 122 Marvin Elwood Road Monticello MN 55362 Anderson, Fred 122 Marvin Elwood Road Monticello MN 55362 Bitzer, Gladys 406 Cedar Street Apt 210 Monticello MN 55362 Brauch, Donna 136 Jerry Liefert Drive PO Box 122 Monticello MN 55362 Broekemeier, Pam 5801 Summit Pointe Rd Monticello MN 55362 Carlson, David 6214 Mill Run Rd Monticello MN 55362 Dahl, Rosemary (lead)1229 Sandy Ln Monticello MN 55362 DeMarais, Agnes 1021 West Broadway Monticello MN 55362 Doucette, Richard 1314 Prairie Creek Lane Monticello MN 55362 Duran, Rosanne (lead)6040 Bakken St Monticello MN 55362 Erickson, Keri 117 Crocus Lane Monticello MN 55362 Fair, Bill 1313 Prairie Creek Lane Monticello MN 55362 Fink, Timothy 731 Minnesota St, Apt 204 Monticello MN 55362 Gilberts, Lana 9392 Red Rock Ln Monticello MN 55362 Gilberts, Mark 9392 Red Rock Ln Monticello MN 55362 Gillham, Lynnea 915 W. Broadway Monticello MN 55362 Gordon, Jacquelin 660 Riverview Drive Unit 550 Monticello MN 55362 Grabinski, Robert 1610 Oak Ridge Circle Monticello MN 55362 Hoffarth, William 104 Kenneth Lane Monticello MN 55362 Hoskins, Darla 11705 Spruce Drive Monticello MN 55362 Hultberg, Lois 617 Vine Lane Monticello MN 55362 Kendall, Harvey 108 Hillcrest Road Monticello MN 55362 Lenzen, Mary (lead)220 Front Street Monticello MN 55362 Moody, Judy 118 Kampa Circle Monticello MN 55362 Nesland, MerriJo (Jo)330 E Third Street Monticello MN 55362 Norling, Carol 9237 Goodrich Drive Monticello MN 55362 Norling, Lonnie 9237 Goodrich Drive Monticello MN 55362 Opay, Frank 100 Hillcrest Circle Monticello MN 55362 Ordonez, Denise 230 E Kjellberg Pk PO Box 1189 Monticello MN 55362 Peters, Diane 1120 Sandy Lane Monticello MN 55362 Quick, Richard (Head)113 4th Street SE Monticello MN 55362 Rhoades, Alyssa (lead)9317 Homestead Circle Monticello MN 55362 Sanborn, James 6696 East Oak Drive Monticello MN 55362 Seefeldt, Merrlyn 167 Jerry Liefert Drive Monticello MN 55362 Smith, Jeanette 604 Vine Lane Monticello MN 55362 Solberg, Darlene 11693 Spruce Drive Monticello MN 55362 Sonju-Thielman, Patricia 1344 Prairie Creek Lane Monticello MN 55362 Spiers, Julie (lead)3623 Brentwood Drive Monticello MN 55362 Stevenson, Jim 512 Vine Street Monticello MN 55362 1 MINNESOTA STATUTES 2013 204B.21 204B.21 APPOINTMENT OF ELECTION JUDGES. Subdivision 1.Appointment lists;duties of political parties and secretary of state.On May 1 in a year in which there is an election for a partisan political office,each major political party shall prepare a list of eligible voters to act as election judges in each election precinct.The political parties shall furnish the lists electronically to the secretary of state,in a format specified by the secretary of state.The secretary of state must combine the data received from each political party under this subdivision and must process the data to locate the precinct in which the address provided for each potential election judge is located.If the data submitted by a political party is insufficient for the secretary of state to locate the proper precinct,the associated name must not appear in any list forwarded to an appointing authority under this subdivision.The secretary of state shall notify political parties of any proposed election judges with addresses that could not be located in a precinct. By May 15,the secretary of state shall furnish electronically to the county auditor a list of the appropriate names for each election precinct in the jurisdiction of the appointing authority,noting the political party affiliation of each individual on the list.The county auditor must promptly forward the appropriate names to the appropriate municipal clerk. Subd.2.Appointing authority;powers and duties.Election judges for precincts in a municipality shall be appointed by the governing body of the municipality.Election judges for precincts in unorganized territory and for performing election-related duties assigned by the county auditor shall be appointed by the county board.Election judges for a precinct composed of two or more municipalities must be appointed by the governing body of the municipality or municipalities responsible for appointing election judges as provided in the agreement to combine for election purposes.Except as otherwise provided in this section,appointments shall be made from lists furnished pursuant to subdivision 1 subject to the eligibility requirements and other qualifications established or authorized under section 204B.19.At least two election judges in each precinct must be affiliated with different major political parties.If no lists have been furnished or if additional election judges are required after all listed names in that municipality have been exhausted,the appointing authority may appoint other individuals who meet the qualifications to serve as an election judge,including persons who are not affiliated with a major political party.The appointments shall be made at least 25 days before the election at which the election judges will serve,except that the appointing authority may pass a resolution authorizing the appointment of additional election judges within the 25 days before the election if the appointing authority determines that additional election judges will be required. History:1981 c 29 art 4 s 21;1983 c 303 s 8;1986 c 444;1987 c 212 s 5;1999 c 132 s 19; 2008 c 295 s 11,12;2010 c 180 s 2,3;2010 c 184 s 15 Copyright ©2013 by the Office of the Revisor of Statutes,State of Minnesota.All Rights Reserved. CityCouncilAgenda:06/23/14 1 5E.ConsiderationofapprovingindividualpensioncontributionamountforVolunteer FirefighterReliefAssociationmembers (WO/JohnBauer) A.REFERENCEANDBACKGROUND: TheMonticelloVolunteerFirefightersReliefAssociationmembershipisrequestinga $250increaseinthebenefitlevelusedinretirementcalculations.Thebenefitwould increasefrom$2,850to$3,100peryear.The$3,100istheamountpaidforeachyearof serviceformemberswhoarefullyvested.Amemberbecomesfullyvestedafter20years ofservicetothefiredepartment.Amemberretiringbeforebecomingfullyvestedis eligibleforaportionofthe$3,100asdeterminedbyyearsofservice.Theearliestfully andpartiallyvestedmemberscanreceivetheirbenefitisage50,regardlessofwhenthey retire. Thefollowingisasummaryofthepreviousbenefitchangesthathavebeenapproved: Year BenefitAmount 2000 $2,085 2001 $2,175 2003$2,225 2004$2,625 2005$3,050 2006$3,275 2007$3,950 2008$3,500 2009$2,650 2010$2,650 2011$2,750 2012$2,750 2013$2,850 2014(proposed)$3,100 ByAugust1st ofeachyear,theFireReliefAssociationpresentstotheCityCouncila scheduleoftheproposedbenefitsandthetotalliabilitiesassociatedwiththeproposed benefitincomparisontotheassetsoftheassociation.Theincludedschedulesindicate thethreebenefitamountstomembersplustherequiredcitycontribution(none). Basedona$3,100proposedbenefit,thefinancialreportshowsthetotalamountof liabilitythatwouldexistforthepensionamountforthenexttwoyearsandalsoincludes informationontheAssociation’scurrentassetsandprojectedincomeforthenextyear.At around4.9%,thetotalincomeprojectionsforinterestandassetappreciationmightnotbe consideredconservative.However,thesurpluswiththeseprojectionsisprojectedat $163,681.Futurebenefitlevelscanbeadjustedasmarketandotherfactorschange.The deferralrateforvestedretiredmembersisproposedtodeclineto2.5%from5%,whichis themaximumallowedbylaw.Thedeferralrateappliestobalancesofretiredmembers whohavenotreachedtheageof50andbecomeseffectiveJanuary1,2015. CityCouncilAgenda:06/23/14 2 A1.BudgetImpact:Thebenefitlevelhasnoimpactonthecity’sbudget. A2.StaffWorkloadImpact:Thereisnostaffimpactwiththisdecision. B.ALTERNATIVEACTIONS: 1.Motiontosetthe2014pensionbenefitlevelat$3,100forcurrentFireRelief Associationmembersandthedeferralrateat2.5%forpastmembers. 2.Motiontograntanalternativebenefitslevel. C.STAFFRECOMMENDATION: CitystaffsupportsAlternative#1. D.SUPPORTINGDATA: ScheduleFormsSC-14forLumpSumPensionPlans,ReportingYear2014 2013MonticelloFireReliefAssnannualaudit FormSC-14 Page1 ScheduleFormforLump-SumPensionPlans ReportingYear2014 DeterminationofPlanLiabilitiesandRequiredMunicipalContributionfor2015 ReliefAssociation:County/ Counties: EnterAnnualbenefitlevelineffectfor2014:3,100 (Ifyouchangeyourbenefitlevelbefore12/31/2014,theSCmustberecalculatedatthenewlevel.) 20142015 SubtotalofPage1Liability-ActiveMembers 908,486982,824 ActiveMemberInformationPleaseEnterDatesinthisformat: Leavesof Dateof FireDepartment Entry Absence andBreaks in Returnto Service YearsYears Birth Date Service Member of Accrued of Accrued Name Status (months)?Service Liability Service Liability 1 BradE.FyleActive 06/17/195705/01/198403196,1003299,200 2 MarcA.SimpsonActive 02/24/195601/19/198702886,8002989,900 3 NealB.KranzActive 04/06/196605/01/198702886,8002989,900 4 JeffE.MichaelisPaid 08/02/196301/03/19900250260 5 JeffD.KranzActive 05/30/196305/01/199302268,2002371,300 6 RickT.LymerActive 04/29/196305/01/199342165,1002268,200 7 ToddM.JohnsonActive 02/07/196605/01/199302268,2002371,300 8 SteveW.JoergActive 05/24/196310/17/199402062,0002165,100 9 LukeG.DahlheimerDeferred 08/30/197205/01/19960190200 10 SteveA.HansonActive 06/08/196705/01/199601957,1642062,000 11 SteveC.BalonActive 06/10/196801/15/199901644,2681748,360 12 DarylR.GilesActive 11/02/196801/15/200001540,4241644,268 13 ShawnG.LeachActive 02/20/197709/03/200101333,1701436,704 14 DonaldA.AndersonActive 10/15/196905/19/200301229,8221333,170 15 JohnP.BauerActive 07/01/197105/19/200301229,8221333,170 16 JasonP.RoubinekActive 11/06/197406/15/200501023,5601126,598 17 KeithPetersonActive 11/07/197901/15/20070817,856920,646 18 KenKakoActive 05/24/197301/15/20070817,856920,646 19 MichealR.DoyleSeparated/NotVested 01/27/197401/15/200748090 20 TimothyA.IngleActive 01/30/197101/15/20073817,856920,646 21 KurtisLiefertActive 04/08/198308/15/20080612,710715,252 22 MichaelD.MosseyActive 12/15/198408/15/20080612,710715,252 23 ThomasM.JohnsonActive 08/15/198408/15/20080612,710715,252 24 JakeOlingerActive 11/15/198407/18/2011035,89048,060 25 JasonMooresActive 06/07/197707/18/2011035,89048,060 26 ScottGeareyActive 10/06/197710/24/2011035,89048,060 27 JoshSamuelsonActive 10/05/198608/20/2012023,84435,890 28 TonyFairActive 10/21/198609/17/2012023,84435,890 29 ChooseStatus 00 30 ChooseStatus 00 31 ChooseStatus 00 32 ChooseStatus 00 33 ChooseStatus 00 Toendof2015Toendof2014 6/17/2014 MonticelloFireReliefAssociation Wright FormSC-14 Page2 DeferredMemberInformation (fullyorpartiallyvested) Seeseparateinstructionsregardingcompletionofthebelowfields. Pleaseenterdatesinthisformat: TotalDeferredMemberLiabilities2014 135,577 TotalDeferredMemberLiabilities2015 142,356 1 Enterallinformationasitpertainstothismember. BenefitLevel Monthsof MemberName:atSeparation:3,275 ServiceArePaid Yes MinimumYearsRequiredtoVest:10 DOB:12/12/1964DeferredInterestPaid ServiceDates:Entry:05/01/1993 Separation:11/01/2006 (Select"Yes"ifoffered.)Yes LOAsandBIS(inmonths):6 Vesting%:72 ReturntoServiceMember?(Select"Yes"ifapplicable.)IfInterestisPaid,ChooseType: TotalService:Years:13 Months(ifpaid):0 2014EstimatedLiability:41,423PeriodInterestisPaid: 2015EstimatedLiability:43,494 Status:Deferred ForReliefRORupto5%,OSARORupto5%orBoardSetRORupto5%enterinterestratesbelow. 1983:%1988:%1993:%1998:%2003:%2009:5.00 % 1984:%1989:%1994:%1999:%2004:%2010:5.00 % 1985:%1990:%1995:%2000:%2005:5.00 %2011:0.00 % 1986:%1991:%1996:%2001:%2006:5.00 %2012:5.00 % 1987:%1992:%1997:%2002:%2007:5.00 %2013:5.00 % +RateofreturniscalculatedusingtheearningsprojectedonPage4ofthisform.2008:0.00 %2014:5.00 %+ 2 Enterallinformationasitpertainstothismember. BenefitLevel Monthsof MemberName:atSeparation:2,750 ServiceArePaid Yes MinimumYearsRequiredtoVest:10 DOB:04/26/1974DeferredInterestPaid ServiceDates:Entry:01/15/1999 Separation:11/04/2011 (Select"Yes"ifoffered.)Yes LOAsandBIS(inmonths):0 Vesting%:68 ReturntoServiceMember?(Select"Yes"ifapplicable.)IfInterestisPaid,ChooseType: TotalService:Years:12 Months(ifpaid):9 2014EstimatedLiability:27,601PeriodInterestisPaid: 2015EstimatedLiability:28,981 Status:Deferred ForReliefRORupto5%,OSARORupto5%orBoardSetRORupto5%enterinterestratesbelow. 1983:%1988:%1993:%1998:%2003:%2009:% 1984:%1989:%1994:%1999:%2004:%2010:% 1985:%1990:%1995:%2000:%2005:%2011:0.00 % 1986:%1991:%1996:%2001:%2006:%2012:5.00 % 1987:%1992:%1997:%2002:%2007:%2013:5.00 % +RateofreturniscalculatedusingtheearningsprojectedonPage4ofthisform.2008:%2014:5.00 %+ MonticelloFireReliefAssociation GeraldJ.Sonsteby FullCalendarMonths BoardsetRORupto5% BoardsetRORupto5% NickM.Dahlheimer FullCalendarMonths 6/17/2014 FormSC-14Page2-Cont. 3 Enterallinformationasitpertainstothismember. BenefitLevel Monthsof MemberName:atSeparation:2,750 ServiceArePaid Yes MinimumYearsRequiredtoVest:10 DOB:07/30/1972DeferredInterestPaid ServiceDates:Entry:04/15/2000 Separation:10/17/2011 (Select"Yes"ifoffered.)Yes LOAsandBIS(inmonths):12 Vesting%:60 ReturntoServiceMember?(Select"Yes"ifapplicable.)IfInterestisPaid,ChooseType: TotalService:Years:10 Months(ifpaid):6 2014EstimatedLiability:20,056PeriodInterestisPaid: 2015EstimatedLiability:21,059 Status:Deferred ForReliefRORupto5%,OSARORupto5%orBoardSetRORupto5%enterinterestratesbelow. 1983:%1988:%1993:%1998:%2003:%2009:% 1984:%1989:%1994:%1999:%2004:%2010:% 1985:%1990:%1995:%2000:%2005:%2011:0.00 % 1986:%1991:%1996:%2001:%2006:%2012:5.00 % 1987:%1992:%1997:%2002:%2007:%2013:5.00 % +RateofreturniscalculatedusingtheearningsprojectedonPage4ofthisform.2008:%2014:5.00 %+ 4 Enterallinformationasitpertainstothismember. BenefitLevel Monthsof MemberName:atSeparation:2,850 ServiceArePaid Yes MinimumYearsRequiredtoVest:10 DOB:08/30/1972DeferredInterestPaid ServiceDates:Entry:05/01/1996 Separation:12/01/2013 (Select"Yes"ifoffered.)Yes LOAsandBIS(inmonths):0 Vesting%:88 ReturntoServiceMember?(Select"Yes"ifapplicable.)IfInterestisPaid,ChooseType: TotalService:Years:17 Months(ifpaid):7 2014EstimatedLiability:46,497PeriodInterestisPaid: 2015EstimatedLiability:48,822 Status:Deferred ForReliefRORupto5%,OSARORupto5%orBoardSetRORupto5%enterinterestratesbelow. 1983:%1988:%1993:%1998:%2003:%2009:% 1984:%1989:%1994:%1999:%2004:%2010:% 1985:%1990:%1995:%2000:%2005:%2011:% 1986:%1991:%1996:%2001:%2006:%2012:% 1987:%1992:%1997:%2002:%2007:%2013:5.00 % +RateofreturniscalculatedusingtheearningsprojectedonPage4ofthisform.2008:%2014:5.00 %+ MonticelloFireReliefAssociation TimW.Ackerman LukeG.Dahlheimer BoardsetRORupto5% FullCalendarMonths BoardsetRORupto5% FullCalendarMonths FormSC-14 MonticelloFireReliefAssociation Page3 UnpaidInstallments Enterherethenameofeachmemberwhohasbeenpaidportionsofhispensionbenefitandwhostillhas outstandingliabilities.Enterdatesinthisformat:6/17/2014 BirthEntrySeparationAmount2014Estimated2015Estimated Name Status Date Date Date PreviouslyPaid Liability Liability UnpaidInstallment UnpaidInstallment UnpaidInstallment UnpaidInstallment UnpaidInstallment UnpaidInstallment UnpaidInstallment UnpaidInstallment UnpaidInstallment UnpaidInstallment Totals 0 0 FormSC-14Page4 CalculationofNormalCost TotalActiveMemberLiabilities TotalDeferredMemberLiabilities TotalUnpaidInstallments GrandTotalSpecialFundLiability A.1,044,063B.1,125,180 NormalCost (CellBminusCellA)C.81,117 ProjectionofNetAssetsforYearEndingDecember31,2014 SpecialFundAssetsatDecember31,2013(RF-13endingassets)1 1,114,949 ProjectedIncomefor2014 StateFireAid (regularstatefireaidandsupplementalstateaid)D.109,594 Municipal/IndependentFireDept.Contributions E.0 Interest/Dividends F.30,000 Appreciation/(Depreciation)G.25,000 MemberDues H. OtherRevenues I.1,000 TotalProjectedIncomefor2014(AddLinesDthroughI)2 165,594 ProjectedExpensesfor2014 ServicePensions J.69,400 MemberNames: OtherBenefits K. AdministrativeExpenses L.3,399 TotalProjectedExpensesfor2014(AddLinesJthroughL)3 72,799 ProjectedNetAssetsatDecember31,2014(AddLines1and2,subtractLine3)4 1,207,744 ProjectionofSurplusor(Deficit)asofDecember31,2014 ProjectedAssets (Line4)5 1,207,744 2014AccruedLiability(Page4,cellA)6 1,044,063 Surplusor(Deficit)(Line5minusLine6)7 163,681 0 MonticelloFireReliefAssociation 20142015 982,824 142,356 0 JeffE.Michaelis($69,400) 908,486 135,577 FormSC-14Page4-Cont. CalculationofRequiredContribution YearIncurred 2005 2006 2007 2008 2009 2010 2011 2012 2013 2014 Totals NormalCost (Page4,cellC)8 81,117 ProjectedAdministrativeExpense Enter2013AdminExphere:93,284 3,399 AmortizationofDeficit (TotalofOriginalAmountcolumnx0.10)10 0 10%ofSurplus (Line7x0.10)11 16,368 StateFireAid 12 109,594 MemberDues 13 0 5%ofProjectedAssetsatDecember31,2014(Line4x0.05)14 60,387 15 0RequiredContribution(AddLines8,9and10,subtractLines11,12,13and14.Ifnegative,zeroisdisplayed.) 38,92538,925 0 0 0 38,925 0 0 38,925 0 0 0 00 0 asof12/31/2013 0 0 0 asof12/31/2014toRetire1/1/2015 DeficitInformation-Adjusted AmountRetiredAmountLeft MonticelloFireReliefAssociation AmountRetired DeficitInformation-Original Norequiredcontributionduein2015. OriginalAmountOriginalAmount 0 0 FormSC-14 MonticelloFireReliefAssociation Page5 SignatureofPresidentFirstNameLastNameDate SignatureofSecretaryFirstNameLastNameDate SignatureofTreasurerFirstNameLastNameDate Iamthemunicipalclerkof/secretaryoftheindependentnonprofit FirstNameLastNameDate BusinessTelephone ThisScheduleFormmustbefullycompleted,certifiedbythereliefassociationofficers,forwardedtothemunicipalclerk/independentsecretaryonorbeforeAugust 1,2014,andsubmittedtotheOfficeoftheStateAuditortobeeligibleforStateFireAid. OfficerCertification We,theofficersoftheMonticelloFireReliefAssociation,certifythatthisScheduleFormwaspreparedunderMinn.Stat.§424A.092andthattheannualbenefitlevelof $3,100peryearofservicewasestablishedaccordingtotheaverageamountofavailablefinancing. WefurthercertifythatbasedonthefinancialrequirementsoftheReliefAssociation'sSpecialFundforthe2014calendaryear,therequired2015contributionis$0.Ifthe bylawsoftheReliefAssociationchangedin2014,wehaveattachedacopyoftheamendmentorupdatedbylaws.Wehavealsoenclosedacopyofthemunicipal/board ratificationofthisamendmentifrequiredunderMinn.Stat.§424A.092,subd.6. PleaseretainacopyofthisScheduleFormforyourrecords,uploadtheformtotheOfficeoftheStateAuditor'swebsite,andelectronicallysigntheform.Alternatively,asignedpapercopycan besubmittedto:OfficeoftheStateAuditor,PensionDivision,525ParkStreet,Suite500,SaintPaul,MN55103.Fax:651-282-5298.Telephone:651-282-6110. Pleaseprovidethetelephonenumbersfortheworklocation(s)atwhichyouconductreliefassociationbusiness. THISCONTACTINFORMATIONISPUBLIC;ITWILLBEAVAILABLETOANYONEONREQUEST. IhavereviewedLine15oftheScheduleForm.IfLine15showsarequiredcontribution,IcertifythatIwilladvisethegoverningmunicipalbodyortheindependentnonprofit firefightingcorporationofanyrequiredcontributionatitsnextregularlyscheduledmeeting. MunicipalClerk/IndependentSecretaryCertification* SignatureofMunicipalClerk/Secretaryofindependentnonprofit firefightingcorporation ,thecompletedScheduleFormfromtheMonticelloFireReliefAssociation. *Seetheforminstructionsforadditionalinformationaboutcertificationrequirements. firefightingcorporation.Ireceivedon CityCouncilAgenda:06/23/14 1 5F.ConsiderationofapprovingaSpecialEventPermitallowinguseofcitystreetsand relatedassistancefortheDowntownBlockPartyonJuly9,2014.Applicant: MonticelloChamber (AS) A.REFERENCEANDBACKGROUND: TheCityCouncilisaskedtoconsiderapprovalofaspecialeventpermitfortheDowntown BlockParty,occurringonWednesday,July9,2014.Aspartoftheapproval,theCityCouncil isaskedtoconsidertheclosureofWalnutStreet,theuseofthe3rd Streetparkinglot,and relatedCityassistanceandequipmentfortrafficcontrolandeventamenities. Inspecific,theapplicationliststhefollowingrequestedCityassistance: “NoParking”signsplacedonWalnut(July8th) StreetbarricadesonWalnut(July9th) BarricadesinThirdSt.parkinglot(July8th) Pedestriancrosswalkmarkers(July9th) Trashreceptacles,picnictables,trafficcones(July9th) TheapplicantfortheeventistheChamberofCommerce,onbehalfofthedowntownarea businesses. Similartopreviousyears,therequestincludestheclosureofWalnutStreetbetween BroadwayWestandThirdStreet.Theeventwillutilizetheentirerightofway,including portionsoftheboulevardinfrontofWalnutStreetbusinessesinthatarea.Theapplicant hasrequestedthatthestreetbeclosedbetween7:00AMand10:00PMtoaccommodate volunteerset-upandtake-downbeforeandaftertheevent.Theeventitselfwilloccur from4:30PMto9:00PM. Aspartoftheclosure,“NoParking”signsarealsorequestedalongWalnutbetween BroadwayandThirdStreetbeginningonTuesdayevening,July8th,toensurenocarsare parkedinthisareathedayoftheevent. CouncilapprovalisalsorequestedforuseofthemunicipalparkinglotalongThirdStreet foreventactivities.For2014,theapplicantisrequestingtheabilitytostakea30’x40’ tentintheThirdStreetparkinglot.SimilartotheTasteoftheTownevent,which includestentstakinginthecity’scommuterlot,anyholesinthelotwillrequirepatching tothesatisfactionofthePublicWorksdepartment.ThetentwillbesetupTuesdayand removedThursday.Therefore,theapplicantisrequestingtheuseofthatportionofthe ThirdStreetparkinglotbeginningonTuesday,July8th throughaportionofThursday, July10th. Aspartofthestreetclosureandparkinglotuse,thegroupisalsoseekingcityassistance forprovidingandplacingpicnictables,deliveryofrequestedbarricadesandtrash containersfortheevent. CityCouncilAgenda:06/23/14 2 Lastly,theeventorganizershaverequestedpermissiontoplaceatemporarysign promotingtheeventatthewastewatertreatmentplant.Communityeventsignageis allowedatthislocation,subjecttoissuanceofasignpermitthroughtheBuilding Department. Asitemapillustratingtheproposedconfigurationofactivities,includingclosurepoints, isincludedandwaspreviouslydevelopedincooperationwiththeMonticelloStreets Superintendent. PublicWorkswillalsonotifyWrightCountyoftheWalnutStreetclosure,asitisclosed attheintersectionofCountyHighway75.Temporarysignagesignalingthisclosurewill beplacedalongWestBroadway/CountyHighway75duringtheevent. TheeventorganizershaveindicatedthattheyhavealsocontactedtheWrightCounty Sheriff’sOfficeregardingtheevent.Theeventwillbestaffedbyoneofficerfromthe Sheriff’sOffice,wellastworeserveofficers. Eventorganizershaveobtainedinsurancetocovertheeventanditsactivitieswiththe Citynamedassecondinsured. ThepropertyandbusinessownersalongthissectionofWalnutStreetwillberequiredto becontactedabouttheBlockParty. TheBlockPartywasdevelopedasawaytopromoteDowntownMonticelloasa communitydestinationforalocaleventthatcanbringpeopleoutoftheirhomesandinto thecoredowntownofthecity,sponsoredbythebusinesscommunityandorientatedto familysocialactivitiesforlocalfellowshipandgathering. A1.BudgetImpact:None. A2.StaffWorkloadImpact:Staffimpactsareasnotedaboveandincludedrop-off andpickupofbarricades,placementof“NoParking”signage,picnictablesand trash/recyclingreceptacles.PublicWorkshasnotedthatwhilethemajorityofthe workassociatedwiththeeventpermitwilltakeplaceduringnormalworking hours,approximately2menworking2hoursofovertimewillbeneededto removetrafficcontroldevicesaftertheeventisdone. B.ALTERNATIVEACTIONS: 1.MotiontoapprovetheSpecialEventPermitallowingtemporaryclosingof WalnutStreetfrom7:00AMuntil10:00PM.onWednesday,July9th,2014, includingtheuseofpublicparkingfacilities,staffresourcesandamenitiesas describedintheSpecialEventPermitapplication,contingenton: a.ContinuedsitecoordinationwithStreetSuperintendent. CityCouncilAgenda:06/23/14 3 b.RestorationoftheThirdStreetparkinglottosatisfactionofPublicWorks department. c.Verificationofnotificationofaffectedlocalbusinessesbypermitholder. d.Applicationfortemporarysignpermitforwastewatertreatmentsite. 2.MotiontodenytheSpecialEventPermitfortemporaryclosureofWalnutStreet anduseofpublicfacilitiesandamenitiesasdescribed. C.STAFFRECOMMENDATION: CitystaffrecommendsAlternative#1above. D.SUPPORTINGDATA: A.Application&Narrative B.SitePlans C.CertificateofInsurance CityCouncilAgenda:06/23/14 1 5G.ConsiderationofapprovingSpecialEventPermitallowinguseofEllisonParkand relatedassistanceinconjunctionwithArtinthePark/TasteofMonticelloon Saturday,July12,2014.Applicant:MonticelloChamberofCommerce (AS/PW) A.REFERENCEANDBACKGROUND: TheCityCouncilisaskedtoconsiderapprovaloftheuseofEllisonPark,aswellas relatedCityassistanceforparkset-up,fortheArtintheParkandtheTasteofMonticello event.TheeventiscoordinatedbytheMonticelloChamberofCommerceandis proposedtooccuronSaturday,July12,2014. Theeventhoursare8AM–3PM.However,theChamberofCommerceisrequesting useoftheparkbeginningat5:00AM.Althoughthenarrativedoesnotrequesttear- downtimeafter3:00PM,thattimeiscustomarilyaccountedforaspartofevent approval.Assuch,theeventapprovalwouldallowuseoftheparkforthiseventfrom 5:00AM–5:00PM. TheChamberhasindicatedthatitwillberesponsibleforset-upandtear-downrelatedto theevent,andwillproviderequiredportablesatellitesandwastedisposalservices.The Chambercoversthecostofthosefacilitiesforthisevent,althoughtheywillalreadybein placeaspartoftheRiverfestevent.TheChamberwillalsocoordinatewiththeSheriff’s Departmentfortrafficcontrolandsecuritypurposes. CityPublicWorksstaffhavepreviouslybeeninvolvedwithassistinginparkpreparation, Therequestistoallowsuchassistance,alongwithwaiverofparkrentalfee,tocontinue for2014. A1.BudgetImpact:Thereisthepotentialforaminorlossofrevenueforparkrental forthedateArtinthePark/TasteofMonticellooccursatEllison.TheMonticello Chamberasksthatthespecialeventpermitbewaivedsincethisispartofthe Riverfestcommunitycelebration.Nootherbudgetimpactisanticipated. A2.StaffWorkloadImpact:TheParksDepartmentstaffwillassistduringtheweek priortotheeventpreparingforthisactivity,inadditiontootherRiverfest activitiesplannedforEllisonPark. B.ALTERNATIVEACTIONS: 1.MotiontoapprovetheSpecialEventPermit,withfeewaiver,allowinguseof EllisonParkandrelatedassistanceinconjunctionwiththeArtinthePark/Taste oftheTowncelebrationonJuly12,2014asdescribedinthestaffreportofJune 23rd,2014,subjecttosubmissionofacertificateofgeneralliabilitycoveragewith theCitynamedasadditionalinsured. 2.MotiontodenytheSpecialEventPermit. CityCouncilAgenda:06/23/14 2 C.STAFFRECOMMENDATION: CitystaffsupportsAlternative#1infavoroftheSpecialEventpermitforArtinthe Park/TasteofMonticelloandrecommendswaivingthepermitfee. D.SUPPORTINGDATA: A.ArtinthePark/TasteofMonticelloApplication&Narrative B.ArtinthePark/TasteofMonticelloMap CityCouncilAgenda:06/23/14 1 5H.ConsiderationofapprovingSpecialEventPermitallowinguseofEllisonPark,West BridgePark,PioneerPark,andCommunityCenterParkingLotandrelated assistanceinconjunctionwiththeannualRiverfestcelebrationonJuly10-13,2014. Applicant:RiverfestCommittee (AS/PW) A.REFERENCEANDBACKGROUND: TheCityCouncilisaskedtoconsiderapprovalofuseofMonticelloparkfacilitiesand relatedCityassistancefortheannualcommunityfestivalofRiverfest. Asinpreviousyears,theRiverfestCommitteeisplanningeventsforThursdaythrough Sundaythroughoutthecommunity.Thisyear’seventswilloccurThursday,July10th throughSunday,July13th.Afulllistingofeventsandactivitieshasbeenprovidedbythe Committee.TheseeventswillincludeactivitiesatPioneerPark,theBridgeParks,the MonticelloCommunityCenterandEllisonPark.Thepermitrequestalsoincludesthe closureanduseofpublicrightsofwayinconjunctionwiththeRiverfestparadeon SundayandclosureanduseofparkinglotoftheMonticelloCommunityCenteron Saturdayevening. CityPublicWorksstaffhavepreviouslybeeninvolvedwithassistinginparkpreparation, eventset-upandtrafficcontrol.Approvalofthespecialeventpermitiscontingenton continuedcoordinationwiththePublicWorksDepartmentonsiteplanningandtraffic control. TheFireDepartmenthasalsoprovidedassistanceonsceneduringthecommunity fireworks,whichwilloccuronFridaythe11th for2014.TherequestfromtheRiverfest Committeeistoallowsuchassistancetocontinuefor2014. TheRiverfestCommitteecoordinatesotherneededportablesatellites,trashcontainers, andtrashremoval.TheRiverfestCommitteealsoworkstheWrightCountySherriff’s Departmentfortrafficcontrolandsecuritythroughoutthefestival. TheMonticelloLionsClubsubmittedapplicationsfortemporaryon-saleliquorlicenses inconjunctionwithRiverfestactivitiesatEllisonParkandtheCommunityCenter ParkingLot.ThoseapplicationswereapprovedbyCouncilonMay12,2014andhave beensubmittedtotheStateforsignatures.TheLionsClubhasprovidedaninsurance certificatenamingtheCityasasecondinsuredforthoseevents. EventsatPioneerParkandtheCommunityCenterwillalsoberequiredtobecovered underaliabilitypolicytobeprovidedbytheRiverfestCommittee. ThefulleventlistingprovidedbytheRiverfestCommitteeistremendouslyhelpfulfor Citystaffinbothprovidingtheneededassistanceduringthefestivalandforpromoting theeventviaCitymediasources. CityCouncilAgenda:06/23/14 2 A1.BudgetImpact:Riverfestfireworksarebudgetedoutofliquorfunds.TheCity signedanewthreeyearcontractwiththefireworksvendorin2012.Insurance costsforthefireworksareincludedintheCity’sinsurancepolicies,andthe fireworksvendorwasrequiredtonametheCityandSchoolDistrictasan additionalinsuredontheirpoliciesaswell. Thereisthepotentialforaminorlossofrevenueforparkrentalduringthedates Riverfestactivitiesoccuratthevariousparks.TheRiverfestCommitteeasksthat thespecialeventpermitbewaivedsincethisisacommunitycelebration.No otherbudgetimpactisanticipated. A2.StaffWorkloadImpact:TheParksandStreetsDepartmentstaffspendtime duringthefullweekpriortotheeventpreparingforthevariousactivities.In addition,onetotwodaysfollowingthefestivalarespentinclean-upandfollow- updetails. B.ALTERNATIVEACTIONS: 1.MotiontoapprovetheSpecialEventPermit,withfeewaiver,allowinguseof EllisonPark,WestBridgePark,PioneerPark,andCommunityCenterParking LotandrelatedCitystaffassistanceinconjunctionwiththeannualRiverfest celebrationonJuly10-13,2014,contingenton: i.ContinuedsiteplanandtrafficcontrolcoordinationwithPublicWorks ii.SubmissionofcertificateofliabilitycoveragewithCitynamedas additionalinsuredforPioneerParkandCommunityCenterevents iii.LotclosuresignageandnotificationincoordinationwiththeStreet Superintendentasneeded 2.MotiontodenytheSpecialEventPermit. C.STAFFRECOMMENDATION: CitystaffsupportsAlternative#1infavoroftheSpecialEventpermitforRiverfestand recommendswaivingthepermitfee. D.SUPPORTINGDATA: RiverfestEventApplication&Narrative RiverfestInsuranceCertificate CityCouncilAgenda:06/23/14 1 5I.ConsiderationofapprovingaSpecialEventPermitforoutdoorentertainmentat Chatter’sBar&GrillonJuly11th,2014.Applicant:Steffens,Brooke/Chatters Restaurant.(AS) A.REFERENCEANDBACKGROUND: TheCityhasreceivedaSpecialEventpermitapplicationforliveentertainmentactivities after10:00PM. ForCouncil’sreference,SpecialEventpermitsarereviewedatanadministrative(staff) levelunlesstherequestincludesarequestfortheuseofCityresources(includingCity land,stafformaterials).SpecialEventpermitsarealsobroughttotheCityCouncilif thereisthepotentialthattheactivityproposedcouldimpacttheCity’sregulations pertainingtonoise. Thezoningordinancewasamendedin2011toallowCounciltoapproveSpecialEvent permitsforrestaurantsspecifictothistypeofactivity. 5.2(F)(25) (b)Restaurantshavingoutdoorseating(including,butnotlimitedto,seatingfordiningor listeningtoliveorrecordedacousticoramplifiedentertainmentoutsideofthebuilding) shallcomplywiththefollowingstandards: (i)Theoutdoorportionsoftherestaurantshallnotoperateafter10:00P.Munlessa SpecialEventPermitforsucheventshasbeenapprovedbytheCityCouncil. SuchpermitsupersedestheprovisionsofCityCode6-1-10(B). (ii)Theoutdoorseatingareashallnotobstructthemovementofpedestriansalong sidewalksorthroughareasintendedforpublicuse. Inthiscase,Chatter’sRestauranthasappliedforaSpecialEventpermitforFriday evening,July11th,2014.Theiroutdooreventisproposedtotakeplacefrom9:00PMto 1:00AM.Asdescribedbytheapplicantintheirsiteplanandnarrative,itistheirintent tohavealivebandinthewestareaoftheirparkinglot. TheChatterspropertyitselfislocatedinaB-3zoningdistrictandislocateddirectly adjacentonitswestpropertylinetoHighway25.Thesiteissurroundedtothenorth,east andsouthbycommercialproperty.Thepropertyislocatedapproximately735feetfrom thenearestresidentialproperty,whichisintheGrovelandneighborhood.TheGroveland neighborhoodisseparatedfromthesitebybothcommercialpropertyandHighway25. Theapplicant’snarrativeindicatesthatthebandwouldbeorientednorthinsidethetent fortheevent.Byorientingthebandtothenorth,therestaurantisintendingtominimize thepotentialthenoiseimpactstotheresidentialarealocatedtothewest.Therestaurant isalsoproposingtoenclosethebandandactivityareawitha30’x60’tent. CityCouncilAgenda:06/23/14 2 In2010,underthepreviouszoningordinance,Chatter’swasissuedatemporary sales/eventpermitforasimilarevent.Thatwasanadministrativepermit,whichdidnot requireCouncilapproval.TheCitydidreceiveonecomplaintfromtheGroveland neighborhoodregardingnoisecreatedbytheevent. A1.BudgetImpact:None. A2.StaffWorkloadImpact:Minimalstafftimewasnecessarytoreviewtherequest andpreparethisreport.Noadditionalstafftimeisanticipatedforthisrequest. B.ALTERNATIVEACTIONS: 1.MotiontoapprovetheSpecialEventPermitforoutdoorentertainmentat Chatter’sRestaurantBar&GrillforJuly11th,2014. 2.MotiontodenytheSpecialEventPermitforoutdoorentertainmentatChatter’s RestaurantBar&GrillforJuly11th,2014basedonfindingstobemadebythe CityCouncil. C.STAFFRECOMMENDATION: CitystaffrecommendsAlternative#1above. D.SUPPORTINGDATA: SpecialEventPermitApplication&Narrative EventMap CityCouncilAgenda:06/23/2014 1 7A.PublicHearing-Considerationofapproving2013StormWaterPollution PreventionProgram(SWPPP)AnnualReport (WSB) A.REFERENCEANDBACKGROUND: In2005theCityofMonticellowasdesignatedasaregulatedsmallmunicipalseparate stormsewersystem(MS4)underMinnesotaRules,Chapter7090.ThisrequiredtheCity toobtainaNationalPollutantDischargeEliminationSystem/StateDisposalSystem (NPDES/SDS)stormwaterpermitandtodevelopandimplementaStormWater PollutionPrevention(SWPPP)toreducethedischargeofpollutants,includingsediments, fromourstormsewersystemtothemaximumextentpracticable. OnFebruary15,2007theCity’sdraftSWPPPwassubmittedtotheMinnesotaPollution ControlAgency(MPCA)forreviewandapproval.OnMarch24,2008theMPCA approvedthedraftSWPPPandtheCitywasgrantedgeneralpermitcoverage. Asrequired,theSWPPPaddressessixminimumcontrolmeasures(MCM’s)asfollowsto reporton: 1.PublicEducationandOutreach; 2.PublicParticipationandInvolvement; 3.IllicitDischargeDetectionandElimination; 4.ConstructionSiteStormwaterRunoffControl; 5.Post-ConstructionStormwaterManagementMeasures;and 6.PollutionPrevention/GoodHousekeepingMeasures. Atotalof40bestmanagementpractices(BMP’s)andmeasureablegoalsassociatedwith thesixminimumcontrolmeasures(MCM’s)areidentifiedintheSWPPPfor implementation.Ashasbeendiscussedbefore,theseBMP’srequireseveralhoursof stafftimeeachyeartoadministerandcompletethetasksidentifiedinourSWPPP.These tasksincludesuchitemsprovidingarticlesinCitynewslettersandonthewebsite; educatingthepublicatcommunityevents;holdinganannualpublicmeeting;monitoring erosioncontrolonconstructionanddevelopmentsites;andinventoryingandmappingour entirestormsewersystemincludingponds,pipes,structures,outfalls,waterbodies,etc. Repairstothesesystemswillbecompletedasstafftimeandbudgetallows. Eachyearwearerequiredtoconductapublicmeetingtopresentinformationand activitiesassociatedwiththeSWPPPforthepreviousyear.TheCityisalsorequiredto submitanannualreportoftheseactivitiestotheMPCAbyJune30th.Thereport summarizestheCity’sSWPPPimplementationeffortsoverthepreviouscalendaryearfor thesixMCM’s.Thedraft2013annualreportisattachedassupportingdocumentation forCounciltoreviewandapprovepriortosubmittingtotheMPCA.ShouldCouncilwish todirectanychangestothe2013AnnualReport,staffwillmakeanychangesnecessary priortosubmittingthereporttotheMPCAbyJune30th. CityCouncilAgenda:06/23/2014 2 NewPermitRequirements(effectiveAugust1,2013)UpdateonActivities: StaffreportedtoCouncilonJune24,2013,thattheMPCAhadfinalizedandreissueda newMS4GeneralPermit,withwhichallcurrentMS4citiesneededtocomply.Thenew permitbecamelawonAugust1,2013andtheCityhaduntilOctober30th,2013toapply foranewpermittocomplywiththenewrulesandregulations.TheCityappliedforthe permitonOctober30,2013.TheMPCAreviewedthepermitapplicationandthen officiallyapprovedorissuedthepermitonJanuary16,2014.Thenewpermitwillexpire onJuly31,2018,atwhichtimeitislikelyanewpermitwillneedtobeappliedfor subjecttopotentialnewrequirements.Enclosedisacopyofthecurrentpermit applicationineffect,whichidentifiessomeofthesamerequirementsoftheprevious permitand,ingeneral,thefollowingadditionalitemsthatCityistocompletebyJanuary 16,2015.EventhoughthepermitexpiresJuly31,2018,therequirementsstatethatthe followingitemsaretobecompletedwithinoneyearofthepermitissuance,whichis January16,2015. 1.Reviseexistingordinancesrelatedtoillicitdischarge,constructionsiteerosion andsedimentcontrolandpost-constructionstormwatermanagement. 2.DevelopEnforcementResponseProcedures(ERPs)thatwilldescribeinternal staffproceduresforresolvingnon-complianceissuesgeneratedasaresultofa complaintorsiteinspection. 3.Providerecommendationsforhowexistingordinancesandpoliciesmayneedto bemodifiedtoallowtheCitytoconductinspections,performmaintenance,and assesscoststomaintainstructuralstormwaterBMPsforprivatesystems constructedthroughouttheCity(e.g.,commercialproperties,industrialfacilities, etc.). 4.ReviewandupdatetheCity’sexisting IllicitDischargeDetection&Elimination (IDDE)programcomponentstoincludewritteninternalproceduresfor emergencyandnon-emergencyresponsetoreportedspills,illicitdischarges,and connections. 5.Prepareaninspectionmapofhighpriorityareasthatmaycontainthepotentialof increasedillicitdischargesbasedoncurrentlanduse/zoning,historyofreported discharges/spills,andactiveNPDESIndustrialStormwaterPermits. 6.ReviewtheCity’sexistingconstructionsiteandpost-constructionstormwater managementprogramcomponentsforneededupdatestomeetnewMS4permit requirements.ProgramupdatesidentifiedintheCity’sApplicationfor Reauthorizationincludedraftingwritteninternalproceduresforidentifying priorityconstrictionsitesforinspection,revisingplanreviewandinspection checkliststomeetnewNPDESConstructionStormWaterPermitrequirements, andupdatingCityinspectionforms. CityCouncilAgenda:06/23/2014 3 7.DevelopaPublicWorksMS4ProgrammanualthatcanserveastheCity’sMS4 Administrator’sreferenceandreportingdocumentforalloftheCity’spublic worksdepartmentrelatedMS4activities.Thepublicworksmanualwillbe preparedusingasimilarformatastheCity‘sEngineeringDesignGuidelines. Specificprogramcomponentsthatwillbereviewedandupdated(ifneeded) include: Writtenproceduresforconductingandreportingstreetsweepingoperations, outfall,pond,structuralstormwaterBMP,andquarterlyfacilityinspections. Recordkeepingpracticesandmethodologiesforinspectionreporting, determiningmaintenance,repair,replacementofMS4stormsewer components. Draftastafftrainingprogramthatwouldidentifytrainingopportunities, certifications,annualschedules,andrecordkeeping.Thistrainingprogram wouldbeusedannuallybyCitystafftoschedule,conductand/orhoststaff trainingforallMS4responsiblePublicWorksstaff. Again,theaboveitemsneedtobecompletebyJanuary16,2015.Thisisoneyearafter thenewpermitwasissuedforcoverage.StaffandWSBhavealreadystartedworkingon someoftheitems,specificallyitems1and2above. A1.BudgetImpact:Completingthe2013AnnualReporthadnodirectimpacttothe budgetandispartofCityEngineerretainer.Approximately$10,000was budgetedunderProfessionalEngineeringservicesfor2013tocompletethe requiredactivitieslistedaboveasrequiredwiththenewpermit. AshasbeendiscussedpreviouslywiththeCouncil,implementationofastorm waterutilityfeewouldbeinstrumentalinfundingtherequiredMS4permit complianceactivities,includingthemaintenanceandrepairofthestormsewer andpondingsystemswithintheCity.CurrentlytheCityhas121pondsandover 300stormwaterstructureswithseveralmilesofconnectingpipestomaintain. TheconceptofastormwaterutilityfeewouldbesimilartotheCity’ssewerand wateruserfeesthataregeneratedtofundoperationsandmaintenancecostsof thosesystems.Staffwillidentifythesecostswiththe2015budgetprocess. A2.StaffWorkloadImpact:CityStaffhasspenttimepreparingthe2013Annual Reportincludingallbackgrounddocumentationtocompletethereport.Ongoing stafftimefromPublicWorks,Building,andCommunityDevelopment departmentswillberequiredtofulfillthepermitrequirements. B.ALTERNATIVEACTIONS: 1.Motiontoapprovethe2013SWPPPAnnualReportaspresentedandauthorize submittaltotheMPCAbytheJune30th,2014deadline. CityCouncilAgenda:06/23/2014 4 2.Motionforapprovalandsubmittalofthe2013SWPPPAnnualReporttothe MPCA,pendingrevisionsbasedonCouncilinput. 3.Motionofother. C.STAFFRECOMMENDATION: CitystaffrecommendsAlternative#1. D.SUPPORTINGDATA: A.2013SWPPPAnnualReport(draft) B.MPCALetterofIssuanceCoverage C.MS4SWPPPApplicationforReauthorization(effectiveAugust1,2013) www.pca.state.mn.us • 651-296-6300 • 800-657-3864 • TTY 651-282-5332 or 800-657-3864 • Available in alternative formats wq-strm4-06 • 12/19/13 Page 1 of 5 MS4 Annual Report for 2013 Municipal Separate Storm Sewer Systems (MS4s) Reporting period January 1, 2013 to December 31, 2013 Due June 30, 2014 Doc Type: Permitting Annual Report Instructions: By completing this mandatory MS4 Annual Report form, you are providing the Minnesota Pollution Control Agency (MPCA) with a summary of your status of compliance with permit conditions, including an assessment of the appropriateness of your identified best management practices (BMPs) and progress towards achieving your identified measurable goals for each of the minimum control measures as required by the MS4 Permit (permit). If a permittee determines that program status or compliance with the permit can not be adequately reflected within the structure of this form additional explanation and/or information may be referenced in an attachment. This form has limitations and provides only a snap shot of your compliance with the conditions in the permit. After reviewing the information, MPCA staff may need to contact the permittee to clarify or seek additional information. Submittal: This MS4 Annual Report must be submitted electronically to the MPCA using the submit button at the end of the form, from the person that is duly authorized to certify this form. All questions with an asterisk (*) are required fields (these fields also have a red border), and must be completed before the form will send. A manual confirmation e-mail will be sent in response to electronic submissions. If you do not receive an e-mail confirmation within two business days, please contact the program staff below. (If the submit button does work for you, you can save a copy of the form to a location on your computer where you will easily be able to retrieve it. You will then have to attach the form separately to an e-mail once you are within your Internet mail.) If you have further questions, please contact one of these MPCA staff members (toll-free 800-657-3864): • Scott Fox 651-757-2368 scott.fox@state.mn.us • Claudia Hochstein 651-757-2881 claudia.hochstein@state.mn.us • Cole Landgraf 651-757-2880 cole.landgraf@state.mn.us • Dan Miller 651-757-2246 daniel.miller@state.mn.us • Rachel Stangl 651-757-2879 rachel.stangl@state.mn.us General Contact Information (*Required fields) *Name of MS4: *Contact name: *Mailing address: *City: *State: *Zip code: *Phone (including area code): *E-mail: Minimum Control Measure 1: Public Education and Outreach [V.G.1] (*Required fields) A. The permit requires each permittee to implement a public education program to distribute educational materials to the community or conduct equivalent outreach activities about the impacts of stormwater discharges on water bodies and steps that the public can take to reduce pollutants in stormwater runoff. [Part V.G.1.a] Note: Indicate which of the following distribution methods you used. Indicate the number distributed in the spaces provided (enter “0” if the method was not used or “NA” if the data does not exist): Media type Number of media Number of times published Circulation/ Audience Example: Brochures: 3 different brochures published 5 times about 10,000 Brochures: Newsletter: Posters: Newspaper articles: Utility bill inserts: Radio ads: Television ads: Cable Access Channel: Other: Other: Other: www.pca.state.mn.us • 651-296-6300 • 800-657-3864 • TTY 651-282-5332 or 800-657-3864 • Available in alternative formats wq-strm4-06 • 12/19/13 Page 2 of 5 B. *Do you use a website as a tool to distribute stormwater educational materials? Yes No What is the URL: C. If you answered yes in question B. above, do you track hits to the site? Yes No How many hits were to the stormwater page?: D. *Did you hold stormwater related events, presentations to schools or other such activities? Yes No If yes, describe: E. *Have specific messages been developed and distributed during this reporting year for Minimum Control Measure (MCM): MCM 1: Yes No MCM 4: Yes No MCM 2: Yes No MCM 5: Yes No MCM 3: Yes No MCM 6: Yes No F. *Have you developed partnerships with other MS4s, watershed districts, local or state governments, educational institutions, etc., to assist you in fulfilling the requirements for MCM 1? Yes No G. List those entities with which you have partnered to meet the requirements of this MCM and describe the nature of the agreement(s). Attach a separate sheet if necessary: H. *Have you developed methods to assess the effectiveness of your public education/outreach program? Yes No If yes, describe: Minimum Control Measure 2: Public Participation/Involvement [V.G.2] (*Required fields) A. The permit requires you to hold at least one public meeting per year addressing the Stormwater Pollution Prevention Program. You must hold the public meeting prior to submittal to the Commissioner of the annual report. [Part V.G.1.e.] B. *Did you hold a public meeting to present accomplishments and to discuss your Stormwater Pollution Prevention Program (SWPPP)? Yes No If no, explain: C. *What was the date of the public meeting: D. *How many citizens attended specifically for stormwater (excluding board/council members and staff/hired consultants)? E. *Was the public meeting a stand-alone meeting for stormwater or was it combined with some other function (City Council meeting, other public event, etc.)? Stand-alone Combined F. *Each permittee must solicit and consider input from the public prior to submittal of the annual report. Did you receive written and/or oral input on your SWPPP? [Part V.G.2.b.1-3] Yes No G. *Have you revised your SWPPP in response to written or oral comments received from the public since the last annual reporting cycle? [Part V.G.2.c] Yes No If yes, describe. Attach a separate sheet if necessary: www.pca.state.mn.us • 651-296-6300 • 800-657-3864 • TTY 651-282-5332 or 800-657-3864 • Available in alternative formats wq-strm4-06 • 12/19/13 Page 3 of 5 Minimum Control Measure 3: Illicit Discharge Detection and Elimination [V.G.3] (*Required fields) The permit requires permittees to develop, implement, and enforce a program to detect and eliminate illicit discharges as defined in 40 CFR 122.26(b)(2). You must also select and implement a program of appropriate BMPs and measurable goals for this minimum control measure. A. *Did you update your storm sewer system map? Yes No If yes, please explain which components (ponds, pipes, outfalls, waterbodies, etc.) were updated/added: Note: The storm sewer system map was to be completed by June 30, 2008. [Part V.G.3.a] B. *Have you modified the format in which the map is available? Yes No C. If yes, indicate the new format: Hardcopy only GIS system CAD Other system: D. *Did you inspect for illicit discharges during the reporting year? Yes No E. If you answered yes in question D. above, did you identify any illicit discharges? Yes No F. If you answered yes in question E. above, how many illicit discharges were detected during the reporting period? G. If you answered yes in question E. above, did the illicit discharge result in an enforcement action? Yes No If yes, what type of enforcement action(s) was taken (check all that apply): Verbal warning Notice of violation Fines Criminal action Civil penalties Other (describe): Minimum Control Measure 4: Construction Site Stormwater Runoff [V.G.4] (*Required fields) The permit requires that each permittee develop, implement, and enforce a program to reduce pollutants in any stormwater runoff to your small MS4 from construction activities within your jurisdiction that result in a land disturbance of equal to or greater than one acre, including the disturbance of less than one acre of total land area that is part of a larger common plan of development or sale if the larger common plan will ultimately disturb one or more acres. [Part V.G.4.] A. The permit requires an erosion and sediment control ordinance or regulatory mechanism that must include sanctions to ensure compliance and contains enforcement mechanisms [Part V.G.4.a]. Indicate which of the following enforcement mechanisms are contained in your ordinance or regulatory mechanism and the number of actions taken for each mechanism used during the reporting period (enter “0” if the method was not used or “NA” if the data does not exist). Check all that apply. Enforcement mechanism Number of actions Verbal warnings # Notice of violation # Administrative orders # Stop-work orders # Fines # Forfeit of security of bond money # Withholding of certificate of occupancy # Criminal actions # Civil penalties # Other: # B. *Have you developed written procedures for site inspections? Yes No C. *Have you developed written procedures for site enforcement? Yes No www.pca.state.mn.us • 651-296-6300 • 800-657-3864 • TTY 651-282-5332 or 800-657-3864 • Available in alternative formats wq-strm4-06 • 12/19/13 Page 4 of 5 D. *Identify the number of active construction sites greater than an acre in your jurisdiction during the 2013 calendar year: E. *On average, how frequently are construction sites inspected (e.g., weekly, monthly, etc.)? F. *How many inspectors, at any time, did you have available to verify erosion and sediment control compliance at construction sites during the reporting period? Minimum Control Measure 5: Post-construction Stormwater Management in New Development and Redevelopment [V.G.5] (*Required fields) The permit requires each permittee to develop, implement, and enforce a program to address stormwater runoff from new development and redevelopment projects within your jurisdiction that disturb an area greater than or equal to one acre, including projects less than one acre that are part of a larger common plan of development or sale that discharge into your small MS4. Your program must ensure that controls are in place that would prevent or reduce water quality impacts. You must also select and implement a program of appropriate BMPs and measurable goals for this minimum control measure. Note: The MS4 permit requirements associated with this minimum control measure were required to be fully developed and implemented by June 30, 2008. A. *Have you established design standards for stormwater treatment BMPs installed as a result of post-construction requirements? Yes No B. *Have you developed procedures for site plan review which incorporate consideration of water quality impacts? Yes No C. *How many projects have you reviewed during the reporting period to ensure adequate long- term operation and maintenance of permanent stormwater treatment BMPs installed as a result of post-construction requirements? [Part V.G.5.b.and Part V.G.5.c]. D. *Do plan reviewers use a checklist when reviewing plans? Yes No E. *How are you funding the long-term operation and maintenance of your stormwater management system? (Check all that apply) Grants Stormwater utility fee Taxes Other: Minimum Control Measure 6: Pollution Prevention/Good Housekeeping for Municipal Operations [V.G.6] (*Required fields) The permit requires each permittee to develop and implement an operation and maintenance program that includes a training component and has the ultimate goal of preventing or reducing pollutant runoff from municipal operations. Your program must include employee training to prevent and reduce stormwater pollution from activities, such as park and open space maintenance, fleet and building maintenance, new construction and land disturbances, and stormwater system maintenance. A. *The permit requires each permittee to inspect annually all structural pollution control devices, such as trap manholes, grit chambers, sumps, floatable skimmers and traps, separators, and other small settling or filtering devices [Part V.G.6.b.2)] B. *Did you inspect all structural pollution control devices during the reporting period? Yes No C. *Have you developed an alternate inspection frequency for any structural pollution control devices? [V.G.6.b.7)] Yes No *Indicate the total number of structural pollution control devices for which you have developed and alternative inspection frequency: D. *Indicate the total number of structural pollution control devices (for example-grit chambers, sumps, floatable skimmers, etc.) within your MS4, the total number that were inspected during the reporting period, and calculate the percent inspected. Enter “0” if your MS4 does not contain structural pollution control devices or none were inspected. Enter “NA” if the data does not exist: *Total number *Number inspected *Percentage *Structural pollution control devices: E. *Did you repair, replace, or maintain any structural pollution control devices? Yes No www.pca.state.mn.us • 651-296-6300 • 800-657-3864 • TTY 651-282-5332 or 800-657-3864 • Available in alternative formats wq-strm4-06 • 12/19/13 Page 5 of 5 F. *For each BMP below, indicate the total number within your MS4, how many of each BMP type were inspected and the percent inspected during the reporting period. Enter “0” if your MS4 does not contain BMPs or none were inspected. Enter “NA” if the data does not exist: Structure/Facility type *Total number *Number inspected *Percentage *Outfalls to receiving waters: *Sediment basins/ponds: *Total G. Of the BMPs inspected in F.. above, did you include any privately owned BMPs in that number? Yes No H. If yes in G.. above, how many: Section 7: Impaired Waters Review (*Required fields) The permit requires any permittee whose MS4 discharges to a Water of the State, which appears on the current U. S. Environmental Protection Agency (EPA) approved list of impaired waters under Section 303(d) of the Clean Water Act, review whether changes to the SWPPP may be warranted to reduce the impact of your discharge [Part IV.D]. A. *Does your MS4 discharge to any waters listed as impaired on the state 303 (d) list? Yes No B. *Have you modified your SWPPP in response to an approved Total Maximum Daily Load (TMDL)? Yes No If yes, indicate for which TMDL: Section 8: Additional SWPPP Issues (*Required fields) A. *Did you make a change to any BMPs or measurable goals in your SWPPP since your last report? [Part VI.D.3.] Yes No B. If yes, briefly list the BMPs or any measurable goals using their unique SWPPP identification numbers that were modified in your SWPPP, and why they were modified: (Attach a separate sheet if necessary) C. *Did you rely on any other entities (MS4 permittees, consultants, or contractors) to implement any portion of your SWPPP? [Part VI.D.4.] Yes No If yes, please identify them and list activities they assisted with: Owner or Operator Certification (*Required fields) The person with overall administrative responsibility for SWPPP implementation and permit compliance must certify this MS4 Annual Report. This person must be duly authorized and should be either a principal executive (i.e., Director of Public Works, City Administrator) or ranking elected official (i.e., Mayor, Township Supervisor). *Yes - I certify under penalty of law that this document and all attachments were prepared under my direction or supervision in accordance with a system designed to assure that qualified personnel properly gathered and evaluated the information submitted. Based on my inquiry of the person or persons who manage the system, or those persons directly responsible for gathering the information, the information submitted is, to the best of my knowledge and belief, true, accurate, and complete (Minn. R. 7001.0070). I am aware that there are significant penalties for submitting false information, including the possibility of fine and imprisonment (Minn. R. 7001.0540). *Name of certifying official: *Title: *Date: (mm/dd/yyyy) wq-strm4-59p · 1/14/14 · Doc Type: Permit Approval January 16, 2014 Shibani Bisson City of Monticello 505 Walnut Street, Suite 1 Monticello, MN 55362 RE: Issuance of Coverage under the National Pollutant Discharge Elimination System/State Disposal System (NPDES/SDS) General Permit MNR040000 for Municipal Separate Storm Sewer Systems for City of Monticello MS4 Dear Ms. Bisson: In accordance with Minn. R. 7001.0140, the Commissioner of the Minnesota Pollution Control Agency (MPCA) has made a final determination to issue coverage und er the National Pollutant Discharge Elimination System/State Disposal System (NPDES/SDS) General Permit MNR040000 for Municipal Separate Storm Sewer Systems (MS4 General Permit) to the City of Monticello, effective January 16, 2014. Please find enclosed a copy of the above referenced MS4 General Permit. The MPCA’s final decision to issue permit coverage is based on the following: MPCA staff has reviewed your MS4 General Permit application and Stormwater Pollution Prevention Program (SWPPP) Document. Public notice and opportunity for comment on your MS4 General Permit application and SWPPP Document has been provided, and no comments were received. As you know, it is the responsibility of the MS4 owner and/or operator to comply with the requirements of the MS4 General Permit and your SWPPP Document . This issuance of coverage does not preclude the MPCA from following up with an inspection or audit to ver ify compliance with the MS4 General Permit and SWPPP Document. Also, be aware that as a condition of recordkeeping, Part IV.C.3. of the MS4 General Permit requires that the permittee retain their SWPPP Document and all records pertinent to it for at least three (3) years beyond the term of the MS4 General Permit. In addition, for an MS4 that was covered under the previous MS4 General Permit (issuance date June 1, 2006), coverage under that permit is terminated on the coverage date as specified above. An MS4 covered under the new MS4 General Permit is required to report on activities that were required or committed to under the previous permit. wq-strm4-59p · 1/14/14 · Doc Type: Permit Approval City of Monticello Page 2 January 16, 2014 Finally, the MPCA thanks you for your cooperation in the permitting process . Please retain this letter as documentation of your MS4 General Permit coverage under the NPDES/SDS Permit MNR040000. Please contact MS4 team member Scott J. Fox at 651-757-2368 with any questions. Sincerely, Duane Duncanson This document has been electronically signed. Duane Duncanson Supervisor, Municipal Compliance Unit I St. Paul Office Municipal Division cc: City of Monticello file www.pca.state.mn.us • 651-296-6300 • 800-657-3864 • TTY 651-282-5332 or 800-657-3864 • Available in alternative formats wq-strm4-49a • 5/31/13 Page 1 of 15 MS4 SWPPP Application for Reauthorization for the NPDES/SDS General Small Municipal Separate Storm Sewer System (MS4) Permit MNR040000 reissued with an effective date of August 1, 2013 Stormwater Pollution Prevention Program (SWPPP) Document Doc Type: Permit Application Instructions: This application is for authorization to discharge stormwater associated with Municipal Separate Storm Sewer Systems (MS4s) under the National Pollutant Discharge Elimination System/State Disposal System (NPDES/SDS) Permit Program. No fee is required with the submittal of this application. Please refer to “Example” for detailed instructions found on the Minnesota Pollution Control Agency (MPCA) MS4 website at http://www.pca.state.mn.us/ms4. Submittal: This MS4 SWPPP Application for Reauthorization form must be submitted electronically via e-mail to the MPCA at ms4permitprogram.pca@state.mn.us from the person that is duly authorized to certify this form. All questions with an asterisk (*) are required fields. All applications will be returned if required fields are not completed. Questions: Contact Claudia Hochstein at 651-757-2881 or claudia.hochstein@state.mn.us, Dan Miller at 651-757-2246 or daniel.miller@state.mn.us, or call toll-free at 800-657-3864. General Contact Information (*Required fields) MS4 Owner (with ownership or operational responsibility, or control of the MS4) *MS4 permittee name: City of Monticello *County: Wright (city, county, municipality, government agency or other entity) *Mailing address: 505 Walnut Street, Suite 1 *City: Monticello *State: MN *Zip code: 55362 *Phone (including area code): 763-95-2711 *E-mail: sbisson@wsb.eng MS4 General contact (with Stormwater Pollution Prevention Program [SWPPP] implementation responsibility) *Last name: Bisson *First name: Shibani (department head, MS4 coordinator, consultant, etc.) *Title: City Engineer *Mailing address: 505 Walnut Street, Suite 1 *City: Monticello *State: MN *Zip code: 55362 *Phone (including area code): 763-295-2711 *E-mail: sbisson@wsb.eng Preparer information (complete if SWPPP application is prepared by a party other than MS4 General contact) Last name: First name: (department head, MS4 coordinator, consultant, etc.) Title: Mailing address: City: State: Zip code: Phone (including area code): E-mail: Verification 1. I seek to continue discharging stormwater associated with a small MS4 after the effective date of this Permit, and shall submit this MS4 SWPPP Application for Reauthorization form, in accordance with the schedule in Appendix A, Table 1, with the SWPPP document completed in accordance with the Permit (Part II.D.). Yes 2. I have read and understand the NPDES/SDS MS4 General Permit and certify that we intend to comply with all requirements of the Permit. Yes www.pca.state.mn.us • 651-296-6300 • 800-657-3864 • TTY 651-282-5332 or 800-657-3864 • Available in alternative formats wq-strm4-49a • 5/31/13 Page 2 of 15 Certification (All fields are required) Yes - I certify under penalty of law that this document and all attachments were prepared under my direction or supervision in accordance with a system designed to assure that qualified personnel properly gathered and evaluated the information submitted. I certify that based on my inquiry of the person, or persons, who manage the system, or those persons directly responsible for gathering the information, the information submitted is, to the best of my knowledge and belief, true, accurate, and complete. I am aware that there are significant penalties for submitting false information, including the possibility of civil and criminal penalties. This certification is required by Minn. Stat. §§ 7001.0070 and 7001.0540. The authorized person with overall, MS4 legal responsibility must certify the application (principal executive officer or a ranking elected official). By typing my name in the following box, I certify the above statements to be true and correct, to the best of my knowledge, and that this information can be used for the purpose of processing my application. Name: Shibani Bisson (This document has been electronically signed) Title: City Engineer Date (mm/dd/yyyy): 10/30/2013 Mailing address: 505 Walnut Street, Suite 1 City: Monticello State: MN Zip code: 55362 Phone (including area code): 763-295-2711 E-mail: sbisson@wsbeng.com Note: The application will not be processed without certification. www.pca.state.mn.us • 651-296-6300 • 800-657-3864 • TTY 651-282-5332 or 800-657-3864 • Available in alternative formats wq-strm4-49a • 5/31/13 Page 3 of 15 Stormwater Pollution Prevention Program Document I. Partnerships: (Part II.D.1) A. List the regulated small MS4(s) with which you have established a partnership in order to satisfy one or more requirements of this Permit. Indicate which Minimum Control Measure (MCM) requirements or other program components that each partnership helps to accomplish (List all that apply). Check the box below if you currently have no established partnerships with other regulated MS4s. If you have more than five partnerships, hit the tab key after the last line to generate a new row. No partnerships with regulated small MS4s Name and description of partnership MCM/Other permit requirements involved B. If you have additional information that you would like to communicate about your partnerships with other regulated small MS4(s), provide it in the space below, or include an attachment to the SWPPP Document, with the following file naming convention: MS4NameHere_Partnerships. We currently have no partnerships with other MS4s. We will set up a meeting with Wright County Soil and Water Conservation District. II. Description of Regulatory Mechanisms: (Part II.D.2) Illicit discharges A. Do you have a regulatory mechanism(s) that effectively prohibits non-stormwater discharges into your small MS4, except those non-stormwater discharges authorized under the Permit (Part III.D.3.b.)? Yes No 1. If yes: a. Check which type of regulatory mechanism(s) your organization has (check all that apply): Ordinance Contract language Policy/Standards Permits Rules Other, explain: b. Provide either a direct link to the mechanism selected above or attach it as an electronic document to this form; or if your regulatory mechanism is either an Ordinance or a Rule, you may provide a citation: Citation: Direct link: http://www.ci.monticello.mn.us/vertical/sites/%7B46185197-6086-4078-ADDC- 0F3918715C4C%7D/uploads/City_Ordinance_-_Title_7_-_Chapt_10_(Illicit_Discharge).pdf Check here if attaching an electronic copy of your regulatory mechanism, with the following file naming convention: MS4NameHere_IDDEreg. 2. If no: Describe the tasks and corresponding schedules that will be taken to assure that, within 12 months of the date permit coverage is extended, this permit requirement is met: www.pca.state.mn.us • 651-296-6300 • 800-657-3864 • TTY 651-282-5332 or 800-657-3864 • Available in alternative formats wq-strm4-49a • 5/31/13 Page 4 of 15 Construction site stormwater runoff control A. Do you have a regulatory mechanism(s) that establishes requirements for erosion and sediment controls and waste controls? Yes No 1. If yes: a. Check which type of regulatory mechanism(s) your organization has (check all that apply): Ordinance Contract language Policy/Standards Permits Rules Other, explain: Design guidelines b. Provide either a direct link to the mechanism selected above or attach it as an electronic document to this form; or if your regulatory mechanism is either an Ordinance or a Rule, you may provide a citation: Citation: Direct link: http://www.ci.monticello.mn.us/vertical/sites/%7B46185197-6086-4078-ADDC- 0F3918715C4C%7D/uploads/%7B8CC818ED-60E8-443B-B682-FF1801A68CD5%7D.PDF http://www.ci.monticello.mn.us/vertical/Sites/%7B46185197-6086-4078-ADDC- 0F3918715C4C%7D/uploads/613F6819-C4FC-4A33-8077-34B6B6229FF4.pdf Check here if attaching an electronic copy of your regulatory mechanism, with the following file naming convention: MS4NameHere_CSWreg. B. Is your regulatory mechanism at least as stringent as the MPCA general permit to Discharge Stormwater Associated with Construction Activity (as of the effective date of the MS4 Permit)? Yes No If you answered yes to the above question, proceed to C. If you answered no to either of the above permit requirements listed in A. or B., describe the tasks and corresponding schedules that will be taken to assure that, within 12 months of the date permit coverage is extended, these permit requirements are met: Within 12 months the city will review ordinances to insure they meet the new construction general permit. C. Answer yes or no to indicate whether your regulatory mechanism(s) requires owners and operators of construction activity to develop site plans that incorporate the following erosion and sediment controls and waste controls as described in the Permit (Part III.D.4.a.(1)-(8)), and as listed below: 1. Best Management Practices (BMPs) to minimize erosion. Yes No 2. BMPs to minimize the discharge of sediment and other pollutants. Yes No 3. BMPs for dewatering activities. Yes No 4. Site inspections and records of rainfall events Yes No 5. BMP maintenance Yes No 6. Management of solid and hazardous wastes on each project site. Yes No 7. Final stabilization upon the completion of construction activity, including the use of perennial vegetative cover on all exposed soils or other equivalent means. Yes No 8. Criteria for the use of temporary sediment basins. Yes No If you answered no to any of the above permit requirements, describe the tasks and corresponding schedules that will be taken to assure that, within 12 months of the date permit coverage is extended, these permit requirements are met: Within 12 months of permit coverage the city will review current ordinances and make revisions where necessary to meet the requirements of the new permit. Post-construction stormwater management A. Do you have a regulatory mechanism(s) to address post-construction stormwater management activities? Yes No 1. If yes: a. Check which type of regulatory mechanism(s) your organization has (check all that apply): Ordinance Contract language www.pca.state.mn.us • 651-296-6300 • 800-657-3864 • TTY 651-282-5332 or 800-657-3864 • Available in alternative formats wq-strm4-49a • 5/31/13 Page 5 of 15 Policy/Standards Permits Rules Other, explain: Design guidlines b. Provide either a direct link to the mechanism selected above or attach it as an electronic document to this form; or if your regulatory mechanism is either an Ordinance or a Rule, you may provide a citation: Citation: Direct link: http://www.ci.monticello.mn.us/vertical/Sites/%7B46185197-6086-4078-ADDC- 0F3918715C4C%7D/uploads/613F6819-C4FC-4A33-8077-34B6B6229FF4.pdf Check here if attaching an electronic copy of your regulatory mechanism, with the following file naming convention: MS4NameHere_PostCSWreg. B. Answer yes or no below to indicate whether you have a regulatory mechanism(s) in place that meets the following requirements as described in the Permit (Part III.D.5.a.): 1. Site plan review: Requirements that owners and/or operators of construction activity submit site plans with post-construction stormwater management BMPs to the permittee for review and approval, prior to start of construction activity. Yes No 2. Conditions for post construction stormwater management: Requires the use of any combination of BMPs, with highest preference given to Green Infrastructure techniques and practices (e.g., infiltration, evapotranspiration, reuse/harvesting, conservation design, urban forestry, green roofs, etc.), necessary to meet the following conditions on the site of a construction activity to the Maximum Extent Practicable (MEP): a. For new development projects – no net increase from pre-project conditions (on an annual average basis) of: 1) Stormwater discharge volume, unless precluded by the stormwater management limitations in the Permit (Part III.D.5.a(3)(a)). 2) Stormwater discharges of Total Suspended Solids (TSS). 3) Stormwater discharges of Total Phosphorus (TP). Yes No b. For redevelopment projects – a net reduction from pre-project conditions (on an annual average basis) of: 1) Stormwater discharge volume, unless precluded by the stormwater management limitations in the Permit (Part III.D.5.a(3)(a)). 2) Stormwater discharges of TSS. 3) Stormwater discharges of TP. Yes No 3. Stormwater management limitations and exceptions: a. Limitations 1) Prohibit the use of infiltration techniques to achieve the conditions for post-construction stormwater management in the Permit (Part III.D.5.a(2)) when the infiltration structural stormwater BMP will receive discharges from, or be constructed in areas: a) Where industrial facilities are not authorized to infiltrate industrial stormwater under an NPDES/SDS Industrial Stormwater Permit issued by the MPCA. b) Where vehicle fueling and maintenance occur. c) With less than three (3) feet of separation distance from the bottom of the infiltration system to the elevation of the seasonally saturated soils or the top of bedrock. d) Where high levels of contaminants in soil or groundwater will be mobilized by the infiltrating stormwater. Yes No 2) Restrict the use of infiltration techniques to achieve the conditions for post-construction stormwater management in the Permit (Part III.D.5.a(2)), without higher engineering review, sufficient to provide a functioning treatment system and prevent adverse impacts to groundwater, when the infiltration device will be constructed in areas: a) With predominately Hydrologic Soil Group D (clay) soils. b) Within 1,000 feet up-gradient, or 100 feet down-gradient of active karst features. c) Within a Drinking Water Supply Management Area (DWSMA) as defined in Minn. R. 4720.5100, subp. 13. d) Where soil infiltration rates are more than 8.3 inches per hour. Yes No 3) For linear projects where the lack of right-of-way precludes the installation of volume control practices that meet the conditions for post-construction stormwater management Yes No www.pca.state.mn.us • 651-296-6300 • 800-657-3864 • TTY 651-282-5332 or 800-657-3864 • Available in alternative formats wq-strm4-49a • 5/31/13 Page 6 of 15 in the Permit (Part III.D.5.a(2)), the permittee’s regulatory mechanism(s) may allow exceptions as described in the Permit (Part III.D.5.a(3)(b)). The permittee’s regulatory mechanism(s) shall ensure that a reasonable attempt be made to obtain right-of-way during the project planning process. 4. Mitigation provisions: The permittee’s regulatory mechanism(s) shall ensure that any stormwater discharges of TSS and/or TP not addressed on the site of the original construction activity are addressed through mitigation and, at a minimum, shall ensure the following requirements are met: a. Mitigation project areas are selected in the following order of preference: 1) Locations that yield benefits to the same receiving water that receives runoff from the original construction activity. 2) Locations within the same Minnesota Department of Natural Resource (DNR) catchment area as the original construction activity. 3) Locations in the next adjacent DNR catchment area up‐stream 4) Locations anywhere within the permittee’s jurisdiction. Yes No b. Mitigation projects must involve the creation of new structural stormwater BMPs or the retrofit of existing structural stormwater BMPs, or the use of a properly designed regional structural stormwater BMP. Yes No c. Routine maintenance of structural stormwater BMPs already required by this permit cannot be used to meet mitigation requirements of this part. Yes No d. Mitigation projects shall be completed within 24 months after the start of the original construction activity. e. The permittee shall determine, and document, who will be responsible for long-term maintenance on all mitigation projects of this part. f. If the permittee receives payment from the owner and/or operator of a construction activity for mitigation purposes in lieu of the owner or operator of that construction activity meeting the conditions for post-construction stormwater management in Part III.D.5.a(2), the permittee shall apply any such payment received to a public stormwater project, and all projects must be in compliance with Part III.D.5.a(4)(a)-(e). Yes No Yes No Yes No 5. Long-term maintenance of structural stormwater BMPs: The permittee’s regulatory mechanism(s) shall provide for the establishment of legal mechanisms between the permittee and owners or operators responsible for the long-term maintenance of structural stormwater BMPs not owned or operated by the permittee, that have been implemented to meet the conditions for post-construction stormwater management in the Permit (Part III.D.5.a(2)). This only includes structural stormwater BMPs constructed after the effective date of this permit and that are directly connected to the permittee’s MS4, and that are in the permittee’s jurisdiction. The legal mechanism shall include provisions that, at a minimum: a. Allow the permittee to conduct inspections of structural stormwater BMPs not owned or operated by the permittee, perform necessary maintenance, and assess costs for those structural stormwater BMPs when the permittee determines that the owner and/or operator of that structural stormwater BMP has not conducted maintenance. Yes No b. Include conditions that are designed to preserve the permittee’s right to ensure maintenance responsibility, for structural stormwater BMPs not owned or operated by the permittee, when those responsibilities are legally transferred to another party. Yes No c. Include conditions that are designed to protect/preserve structural stormwater BMPs and site features that are implemented to comply with the Permit (Part III.D.5.a(2)). If site configurations or structural stormwater BMPs change, causing decreased structural stormwater BMP effectiveness, new or improved structural stormwater BMPs must be implemented to ensure the conditions for post-construction stormwater management in the Permit (Part III.D.5.a(2)) continue to be met. Yes No If you answered no to any of the above permit requirements, describe the tasks and corresponding schedules that will be taken to assure that, within twelve (12) months of the date permit coverage is extended, these permit requirements are met: All ordinance will be evaluated and updated accordingly to meet the requirement of the MS4 permit issued on 8/1/2013. B.2.a., B.2.b: Amend current post-construction stormwater ordinance, which does not include anything related to volume-control, to incorporate Permit requirements. We will consider additional changes to our current ordinance to give clear guidance to developers and redevelopers in the community. B.3.a.1: We will amend the ordinance on the same schedule as the items in B.2.a and B.2.b. B.3.a.3: We will amend the ordinance to include the exceptions for linear projects as elaborated in the Permit (Part III.D.5.a(3)(b)). This will occur on the same schedule as the items above. www.pca.state.mn.us • 651-296-6300 • 800-657-3864 • TTY 651-282-5332 or 800-657-3864 • Available in alternative formats wq-strm4-49a • 5/31/13 Page 7 of 15 B.4.c: Currently, our ordinance contains nothing about whether routine maintenance can be used towards mitigation requirements. B.4.e: We will review and update code where appropriate to identify and document who is responsible for long-term maintenance of mitigation requirements. B.4.f: We will draft and consider language mandating that money received from an owner/operator of construction activity, in lieu of meeting the conditions for post-construction stormwater management, shall be used for a public stormwater project. We will work on this amendment to our current post-construction stormwater ordinance on the same timeline as the items listed above. B.5.b: Within 12 months we will review and update our city code to include the amendments to our post-construction stormwater ordinance will be language that will ensure maintenance responsibility on structural stormwater BMPs that we do not own or operate. We plan to do this by drafting language that requires maintenance responsibility for structural stormwater BMPs to be tied to property records. III. Enforcement Response Procedures (ERPs): (Part II.D.3) A. Do you have existing ERPs that satisfy the requirements of the Permit (Part III.B.)? Yes No 1. If yes, attach them to this form as an electronic document, with the following file naming convention: MS4NameHere_ERPs. 2. If no, describe the tasks and corresponding schedules that will be taken to assure that, with twelve (12) months of the date permit coverage is extended, these permit requirements are met: We will confer with appropriate staff to provide written procedures for establishing ERPs within 12 months of permit reissuance. B. Describe your ERPs: We currently do not have ERPs, see above implementation plan. IV. Storm Sewer System Map and Inventory: (Part II.D.4.) A. Describe how you manage your storm sewer system map and inventory: We have staff in house that keep our map and database current. The city owns two handheld GPS units. Our map shows all structures along with pipes 12" or larger. B. Answer yes or no to indicate whether your storm sewer system map addresses the following requirements from the Permit (Part III.C.1.a-d), as listed below: 1. The permittee’s entire small MS4 as a goal, but at a minimum, all pipes 12 inches or greater in diameter, including stormwater flow direction in those pipes. Yes No 2. Outfalls, including a unique identification (ID) number assigned by the permittee, and an associated geographic coordinate. Yes No 3. Structural stormwater BMPs that are part of the permittee’s small MS4. Yes No 4. All receiving waters. Yes No If you answered no to any of the above permit requirements, describe the tasks and corresponding schedules that will be taken to assure that, within 12 months of the date permit coverage is extended, these permit requirements are met: C. Answer yes or no to indicate whether you have completed the requirements of 2009 Minnesota Session Law, Ch. 172. Sec. 28: with the following inventories, according to the specifications of the Permit (Part III.C.2.a.-b.), including: 1. All ponds within the permittee’s jurisdiction that are constructed and operated for purposes of water quality treatment, stormwater detention, and flood control, and that are used for the collection of stormwater via constructed conveyances. Yes No 2. All wetlands and lakes, within the permittee’s jurisdiction, that collect stormwater via constructed conveyances. Yes No D. Answer yes or no to indicate whether you have completed the following information for each feature inventoried. 1. A unique identification (ID) number assigned by the permittee. 2. A geographic coordinate. 3. Type of feature (e.g., pond, wetland, or lake). This may be determined by using best professional judgment. Yes No Yes No Yes No www.pca.state.mn.us • 651-296-6300 • 800-657-3864 • TTY 651-282-5332 or 800-657-3864 • Available in alternative formats wq-strm4-49a • 5/31/13 Page 8 of 15 If you have answered yes to all above requirements, and you have already submitted the Pond Inventory Form to the MPCA, then you do not need to resubmit the inventory form below. If you answered no to any of the above permit requirements, describe the tasks and corresponding schedules that will be taken to assure that, within 12 months of the date permit coverage is extended, these permit requirements are met: E. Answer yes or no to indicate if you are attaching your pond, wetland and lake inventory to the MPCA on the form provided on the MPCA website at: http://www.pca.state.mn.us/ms4 , according to the specifications of Permit (Part III.C.2.b.(1)-(3)). Attach with the following file naming convention: MS4NameHere_inventory. Yes No If you answered no, the inventory form must be submitted to the MPCA MS4 Permit Program within 12 months of the date permit coverage is extended. V. Minimum Control Measures (MCMs) (Part II.D.5) A. MCM1: Public education and outreach 1. The Permit requires that, within 12 months of the date permit coverage is extended, existing permittees revise their education and outreach program that focuses on illicit discharge recognition and reporting, as well as other specifically selected stormwater-related issue(s) of high priority to the permittee during this permit term. Describe your current educational program, including any high-priority topics included: Our city provides brochures on our city website and arcticles in the newsetter pertaining to car washing, pet waste, raking grass clippings, etc. The City also provides a local business (Cargill) with maps for their annual pond cleanup. 2. List the categories of BMPs that address your public education and outreach program, including the distribution of educational materials and a program implementation plan. Use the first table for categories of BMPs that you have established and the second table for categories of BMPs that you plan to implement over the course of the permit term. Include the measurable goals with appropriate timeframes that each BMP category will be implemented and completed. In addition, provide interim milestones and the frequency of action in which the permittee will implement and/or maintain the BMPs. Refer to the U.S. Environmental Protection Agency’s (EPA) Measurable Goals Guidance for Phase II Small MS4s (http://www.epa.gov/npdes/pubs/measurablegoals.pdf). If you have more than five categories, hit the tab key after the last line to generate a new row. Established BMP categories Measurable goals and timeframes Brochures Number of website hits City Newsletter Number sent to residents Stormwater Management Website Number of website hits Social Media Number of subscribers E-News - Monthly Number of subscribers BMP categories to be implemented Measurable goals and timeframes 3. Provide the name or the position title of the individual(s) who is responsible for implementing and/or coordinating this MCM: TBD and evaluated: Admin staff or Public Works/Engineering Staff B. MCM2: Public participation and involvement 1. The Permit (Part III.D.2.a.) requires that, within 12 months of the date permit coverage is extended, existing permittees shall revise their current program, as necessary, and continue to implement a public participation/involvement program to solicit public input on the SWPPP. Describe your current program: Each year we present and hear comments on our Stormwater Pollution Prevention Program. We usually do this in the spring. We put a notice in the local paper 30 days prior to the meeting, www.pca.state.mn.us • 651-296-6300 • 800-657-3864 • TTY 651-282-5332 or 800-657-3864 • Available in alternative formats wq-strm4-49a • 5/31/13 Page 9 of 15 2. List the categories of BMPs that address your public participation/involvement program, including solicitation and documentation of public input on the SWPPP. Use the first table for categories of BMPs that you have established and the second table for categories of BMPs that you plan to implement over the course of the permit term. Include the measurable goals with appropriate timeframes that each BMP category will be implemented and completed. In addition, provide interim milestones and the frequency of action in which the permittee will implement and/or maintain the BMPs. Refer to the EPA’s Measurable Goals Guidance for Phase II Small MS4s (http://www.epa.gov/npdes/pubs/measurablegoals.pdf). If you have more than five categories, hit the tab key after the last line to generate a new row. Established BMP categories Measurable goals and timeframes Annual Meeting Number of attendees Appropriate Public Notice Placed ad in local newspaper, advertised on our cable access channel, e-news, and our website scroller 30 days prior to annual meeting. Engineering Website Website Hits BMP categories to be implemented Measurable goals and timeframes 3. Do you have a process for receiving and documenting citizen input? Yes No If you answered no to the above permit requirement, describe the tasks and corresponding schedules that will be taken to assure that, within 12 months of the date permit coverage is extended, this permit requirement is met: 4. Provide the name or the position title of the individual(s) who is responsible for implementing and/or coordinating this MCM: Public Works/Engineering Stafft C. MCM 3: Illicit discharge detection and elimination 1. The Permit (Part III.D.3.) requires that, within 12 months of the date permit coverage is extended, existing permittees revise their current program as necessary, and continue to implement and enforce a program to detect and eliminate illicit discharges into the small MS4. Describe your current program: The City has an ordinance that prohibits illicit discharges and connections. City Staff and public works employees are trained to look for any signs of an illicit discharge while on the job. ERPs guide what actions the City can take after an illicit discharge has been identified. 2. Does your Illicit Discharge Detection and Elimination Program meet the following requirements, as found in the Permit (Part III.D.3.c.-g.)? a. Incorporation of illicit discharge detection into all inspection and maintenance activities conducted under the Permit (Part III.D.6.e.-f.)Where feasible, illicit discharge inspections shall be conducted during dry-weather conditions (e.g., periods of 72 or more hours of no precipitation). Yes No b. Detecting and tracking the source of illicit discharges using visual inspections. The permittee may also include use of mobile cameras, collecting and analyzing water samples, and/or other detailed procedures that may be effective investigative tools. Yes No c. Training of all field staff, in accordance with the requirements of the Permit (Part III.D.6.g.(2)), in illicit discharge recognition (including conditions which could cause illicit discharges), and reporting illicit discharges for further investigation. Yes No d. Identification of priority areas likely to have illicit discharges, including at a minimum, evaluating land use associated with business/industrial activities, areas where illicit discharges have been identified in the past, and areas with storage of large quantities of significant materials that could result in an illicit discharge. Yes No e. Procedures for the timely response to known, suspected, and reported illicit discharges. Yes No www.pca.state.mn.us • 651-296-6300 • 800-657-3864 • TTY 651-282-5332 or 800-657-3864 • Available in alternative formats wq-strm4-49a • 5/31/13 Page 10 of 15 f. Procedures for investigating, locating, and eliminating the source of illicit discharges. Yes No g. Procedures for responding to spills, including emergency response procedures to prevent spills from entering the small MS4. The procedures shall also include the immediate notification of the Minnesota Department of Public Safety Duty Officer, if the source of the illicit discharge is a spill or leak as defined in Minn. Stat. § 115.061. Yes No h. When the source of the illicit discharge is found, the permittee shall use the ERPs required by the Permit (Part III.B.) to eliminate the illicit discharge and require any needed corrective action(s). Yes No If you answered no to any of the above permit requirements, describe the tasks and corresponding schedules that will be taken to assure that, within 12 months of the date permit coverage is extended, these permit requirements are met: We currently do not have written procedures for responding to illicit discharge. Within 12 months of the date permit coverage is extended. We will evaluate and incorporate these into our program. Along with adding industrial businesses onto our high priority map. We will determine ERPs for illicit discharges. Within the next 12 months we will establish training for staff, which will be documented. 3. List the categories of BMPs that address your illicit discharge, detection and elimination program. Use the first table for categories of BMPs that you have established and the second table for categories of BMPs that you plan to implement over the course of the permit term. Include the measurable goals with appropriate timeframes that each BMP category will be implemented and completed. In addition, provide interim milestones and the frequency of action in which the permittee will implement and/or maintain the BMPs. Refer to the EPA’s Measurable Goals Guidance for Phase II Small MS4s (http://www.epa.gov/npdes/pubs/measurablegoals.pdf). If you have more than five categories, hit the tab key after the last line to generate a new row. Established BMP categories Measurable goals and timeframes Ordinance Review ordinance yearly to ensure that is continues to meet the needs of the City and legal requirements. Inspections City employees will continue to be on the lookout for illicit discharges while they perform their normal duties and inspections occur when we receive reports of an illicit discharge. BMP categories to be implemented Measurable goals and timeframes Training We will hold at least one training for applicable staff within the next year in regards to spotting & handling illicit discharges. Training will be documented, scanned and retained electronically. Flow Chart We will design a flow chart (chain of command) for illicit discharges and distribute to applicable staff. 4. Do you have procedures for record-keeping within your Illicit Discharge Detection and Elimination (IDDE) program as specified within the Permit (Part III.D.3.h.)? Yes No If you answered no, indicate how you will develop procedures for record-keeping of your Illicit Discharge, Detection and Elimination Program, within 12 months of the date permit coverage is extended: We will train staff and create an Excel database that will contain pertinent information regarding illicit discharges.We will make a flow chart so all staff knows where to send illicit discharge information for reporting and inspecting. 5. Provide the name or the position title of the individual(s) who is responsible for implementing and/or coordinating this MCM: Public Works/ Engineering Department D. MCM 4: Construction site stormwater runoff control 1. The Permit (Part III.D.4) requires that, within 12 months of the date permit coverage is extended, existing permittees shall revise their current program, as necessary, and continue to implement and enforce a construction site stormwater runoff control program. Describe your current program: www.pca.state.mn.us • 651-296-6300 • 800-657-3864 • TTY 651-282-5332 or 800-657-3864 • Available in alternative formats wq-strm4-49a • 5/31/13 Page 11 of 15 2. Does your program address the following BMPs for construction stormwater erosion and sediment control as required in the Permit (Part III.D.4.b.): a. Have you established written procedures for site plan reviews that you conduct prior to the start of construction activity? Yes No b. Does the site plan review procedure include notification to owners and operators proposing construction activity that they need to apply for and obtain coverage under the MPCA’s general permit to Discharge Stormwater Associated with Construction Activity No. MN R100001? Yes No c. Does your program include written procedures for receipt and consideration of reports of noncompliance or other stormwater related information on construction activity submitted by the public to the permittee? Yes No d. Have you included written procedures for the following aspects of site inspections to determine compliance with your regulatory mechanism(s): 1) Does your program include procedures for identifying priority sites for inspection? Yes No 2) Does your program identify a frequency at which you will conduct construction site inspections? Yes No 3) Does your program identify the names of individual(s) or position titles of those responsible for conducting construction site inspections? Yes No 4) Does your program include a checklist or other written means to document construction site inspections when determining compliance? Yes No e. Does your program document and retain construction project name, location, total acreage to be disturbed, and owner/operator information? Yes No f. Does your program document stormwater-related comments and/or supporting information used to determine project approval or denial? Yes No g. Does your program retain construction site inspection checklists or other written materials used to document site inspections? Yes No If you answered no to any of the above permit requirements, describe the tasks and corresponding schedules that will be taken to assure that, within 12 months of the date permit coverage is extended, these permit requirements are met. Within 12 monthsof permit coverage the city will have reviewed and updated our procedures and code to meet the requirements of the MS4 general permit. D.2.a., The city uses the MPCA SWPPP Checklist for site plan reviews but does not have any estabilished written procedures. The City will develop written procedures for site plan reviews as described in the Permit (Part III.D.4.b). Procedures will be in place within 12 months following the date permit coverage is extended. D.2.b., The City will include a notification to owners and operators proposing construction activity to apply for and obtain coverage uder the MPCA’s construction activity permit into the written procedures fro (D.2.a) as described in the Permit (Part III.D.4.b). Notification will be inclueded in the procedures within 12 months following the date permit coverage is extended. D.2.c., The City will develop written procedures for receipt and consideration of reports of noncompliance or other stormwater related information on construction activity submitted by the public as described in the Permit (Part III.D.4.c). Procedures will be in place within 12 months following the date permit coverage is extended. D.2.d., City will develop written procedures for conducting site ESC inspections as described in the Permit (Part III.D.4.d). Procedures will be in place within 12 months following the date permit coverage is extended 3. List the categories of BMPs that address your construction site stormwater runoff control program. Use the first table for categories of BMPs that you have established and the second table for categories of BMPs that you plan to implement over the course of the permit term. Include the measurable goals with appropriate timeframes that each BMP category will be implemented and completed. In addition, provide interim milestones and the frequency of action in which the permittee will implement and/or maintain the BMPs. Refer to the EPA’s Measurable Goals Guidance for Phase II Small MS4s (http://www.epa.gov/npdes/pubs/measurablegoals.pdf). If you have more than five categories, hit the tab key after the last line to generate a new row. Established BMP categories Measurable goals and timeframes Site Plan Review City Engineering Staff utilizes SWPPP Checklist (wq-strm2-47) for review of NPDES Erosion Control Permits submitted to the department for review. Erosion Protection Maintenance Memo to Builders An erosion control handout, which explains how to properly install a silt fence and other erosion control BMPs is given to the application when a building permit is picked up. www.pca.state.mn.us • 651-296-6300 • 800-657-3864 • TTY 651-282-5332 or 800-657-3864 • Available in alternative formats wq-strm4-49a • 5/31/13 Page 12 of 15 BMP categories to be implemented Measurable goals and timeframes Permit Update Update the City Grading, Building, and ROW permits and Construction Site Stormwater Runoff ordinance to meet MPCA General Permit to Discharge Stormwater Associate with Construction Activity within 12 months following the date permit coverage is extended Checklist for Site Plan Review Update procedures for site plan review annually and incorporate changes into the review process. Prioritize Inspections Ensure at least 10% of inspections conducted annually are performed at deemed high priority inspection sites (e.g., near sensitive receiving waters, projects larger than 5 acres) 4. Provide the name or the position title of the individual(s) who is responsible for implementing and/or coordinating this MCM: Engineering/Building Departments E. MCM 5: Post-construction stormwater management 1. The Permit (Part III.D.5.) requires that, within 12 months of the date permit coverage is extended, existing permittees shall revise their current program, as necessary, and continue to implement and enforce a post-construction stormwater management program. Describe your current program: This portion of the Cities stormwater program is under review and will be updated to meet the requirements of the MS4 permit within 12 months of the date permit coverage is extended. 2. Have you established written procedures for site plan reviews that you will conduct prior to the start of construction activity? Yes No 3. Answer yes or no to indicate whether you have the following listed procedures for documentation of post-construction stormwater management according to the specifications of Permit (Part III.D.5.c.): a. Any supporting documentation that you use to determine compliance with the Permit (Part III.D.5.a), including the project name, location, owner and operator of the construction activity, any checklists used for conducting site plan reviews, and any calculations used to determine compliance? Yes No b. All supporting documentation associated with mitigation projects that you authorize? Yes No c. Payments received and used in accordance with Permit (Part III.D.5.a.(4)(f))? Yes No d. All legal mechanisms drafted in accordance with the Permit (Part III.D.5.a.(5)), including date(s) of the agreement(s) and names of all responsible parties involved? Yes No If you answered no to any of the above permit requirements, describe the steps that will be taken to assure that, within 12 months of the date permit coverage is extended, these permit requirements are met. E.2., The City uses the MPCA SWPPP Checklist for site plan reviews but does not have any estabilished written procedures. The City will develop written procedures for site plan reviews as described in the Permit (Part III.D.5.b.). Procedures will be in place within 12 months following the date permit coverage is extended. E.3., The City will review or create written procedures for documention of post-construciton stomwater management as described in the Permit (Part III.D.5.c.). Procedures will be in place within 12 months following the date permit coverage is extended. 4. List the categories of BMPs that address your post-construction stormwater management program. Use the first table for categories of BMPs that you have established and the second table for categories of BMPs that you plan to implement over the course of the permit term. Include the measurable goals with appropriate timeframes that each BMP category will be implemented and completed. In addition, provide interim milestones and the frequency of action in which the permittee will implement and/or maintain the BMPs. Refer to the EPA’s Measurable Goals Guidance for Phase II Small MS4s (http://www.epa.gov/npdes/pubs/measurablegoals.pdf). If you have more than five categories, hit the tab key after the last line to generate a new row. Established BMP categories Measurable goals and timeframes www.pca.state.mn.us • 651-296-6300 • 800-657-3864 • TTY 651-282-5332 or 800-657-3864 • Available in alternative formats wq-strm4-49a • 5/31/13 Page 13 of 15 Develop & Implement Structural & Non-Structural BMP’s for post construction Continue implementing 2013 through May 31, 2018 Implement the requirements of the Comprehensive Water Resource Management Plan Continue implementing 2013 through May 31, 2018 Continue to annually inspect outfalls, sediment basins, and ponds on an as needed basis. Continue implementing 2013 through May 31, 2018 BMP categories to be implemented Measurable goals and timeframes Update ordinance to meet new permit requirements Within 12 months of extension of permit coverage, revise ordinance to meet permit requirements Develop Written Procedures for Site Plan Review Within 12 months of extension of permit coverage, develop site plan review procedures that must be completed prior to the start of construction activity Document Pertinent Project Information Maintain all related documents pertaining to each new or redeployment project in more user-friendly filing system for better records management. Implement within 6 months. BMP Construction Guidance Develop BMP Construction Guidance document for developers and contractors within 12 months of permit coverage extension. 5. Provide the name or the position title of the individual(s) who is responsible for implementing and/or coordinating this MCM: Site Review Staff/Engineering Departmentt F. MCM 6: Pollution prevention/good housekeeping for municipal operations 1. The Permit (Part III.D.6.) requires that, within 12 months of the date permit coverage is extended, existing permittees shall revise their current program, as necessary, and continue to implement an operations and maintenance program that prevents or reduces the discharge of pollutants from the permittee owned/operated facilities and operations to the small MS4. Describe your current program: The City of Monticello currently has it's outfalls/sediment basins/ponds inspections completed from the 2006 permit. The City will document stockpile and material handling area inspections. City staff sweeps the streets twice a year, at a minimum. 2. Do you have a facilities inventory as outlined in the Permit (Part III.D.6.a.)? Yes No 3. If you answered no to the above permit requirement in question 2, describe the tasks and corresponding schedules that will be taken to assure that, within 12 months of the date permit coverage is extended, this permit requirement is met: Facilities inventroy will be evaluated and updated as needed. 4. List the categories of BMPs that address your pollution prevention/good housekeeping for municipal operations program. Use the first table for categories of BMPs that you have established and the second table for categories of BMPs that you plan to implement over the course of the permit term. Include the measurable goals with appropriate timeframes that each BMP category will be implemented and completed. In addition, provide interim milestones and the frequency of action in which the permittee will implement and/or maintain the BMPs. For an explanation of measurable goals, refer to the EPA’s Measurable Goals Guidance for Phase II Small MS4s (http://www.epa.gov/npdes/pubs/measurablegoals.pdf). If you have more than five categories, hit the tab key after the last line to generate a new row. Established BMP categories Measurable goals and timeframes Street Sweeping Twice per year; 2013 – May 31, 2018 Annual Inspection of Structural Pollution Control Devices Minimum of once/year; 2013 - May 31, 2018 Inspect MS4 Outfalls, Sediment Basins, & Ponds On an as needed basis; 2013 - May 31, 2018 Inspect all exposed stockpiles, storage and material Minimum once/year; 2013 – May 31, 2018 www.pca.state.mn.us • 651-296-6300 • 800-657-3864 • TTY 651-282-5332 or 800-657-3864 • Available in alternative formats wq-strm4-49a • 5/31/13 Page 14 of 15 handling areas Landscaping & Lawn Care Practices Review Minimum once/year; 2013-May 31, 2018 Road Salt Application Review Minimum once/year; 2013 – May 31, 2018 Inspection follow-up to determine repairs, replacement, maintenance, etc Continue to implement through May 31, 2018 Record all stormsewer & pond inspections annually Continue to implement through May 31, 2018 BMP categories to be implemented Measurable goals and timeframes Develop spill Prevention & Control Plans for Municipal Facilities Develop plans describing spill prevention and control procedures by the end of Year 1. Conduct annual spill prevention and response training sessions to all municipal employees. Distribute education materials, i.e. posters and pamphlets, to each municipal facility by the end of year 2. Increase Inspection Frequency of Maintenance Yard Once weekly and after all rain events utilizing a checklist for the inspection that documents findings and allows staff to compare to previous inspections Facility Inventory Continue to develop facilities inventory to include potential pollutants. Create a map of all identified facilities. Pond Assessment Procedures & Schedule In year 1, develop procedures for determining TSS and TP treatment effectiveness of city owned ponds use for treatment of stormwater. Implement schedule in year 2-5 5. Does discharge from your MS4 affect a Source Water Protection Area (Permit Part III.D.6.c.)? a. If no, continue to 6. Yes No b. If yes, the Minnesota Department of Health (MDH) is in the process of mapping the following items. Maps are available at http://www.health.state.mn.us/divs/eh/water/swp/maps/index.htm. Is a map including the following items available for your MS4: 1) Wells and source waters for drinking water supply management areas identified as vulnerable under Minn. R. 4720.5205, 4720.5210, and 4720.5330? Yes No 2) Source water protection areas for surface intakes identified in the source water assessments conducted by or for the Minnesota Department of Health under the federal Safe Drinking Water Act, U.S.C. §§ 300j – 13? Yes No c. Have you developed and implemented BMPs to protect any of the above drinking water sources? Yes No 6. Have you developed procedures and a schedule for the purpose of determining the TSS and TP treatment effectiveness of all permittee owned/operated ponds constructed and used for the collection and treatment of stormwater, according to the Permit (Part III.D.6.d.)? Yes No 7. Do you have inspection procedures that meet the requirements of the Permit (Part III.D.6.e.(1)- (3)) for structural stormwater BMPs, ponds and outfalls, and stockpile, storage and material handling areas? Yes No 8. Have you developed and implemented a stormwater management training program commensurate with each employee’s job duties that: a. Addresses the importance of protecting water quality? Yes No b. Covers the requirements of the permit relevant to the duties of the employee? Yes No c. Includes a schedule that establishes initial training for new and/or seasonal employees and recurring training intervals for existing employees to address changes in procedures, practices, techniques, or requirements? Yes No 9. Do you keep documentation of inspections, maintenance, and training as required by the Permit (Part III.D.6.h.(1)-(5))? Yes No If you answered no to any of the above permit requirements listed in Questions 5 – 9, then describe the tasks and corresponding schedules that will be taken to assure that, within 12 months of the date permit coverage is extended, these permit requirements are met: The city documents inspections and maintenance but we do not have a written training policy in place. The city plans www.pca.state.mn.us • 651-296-6300 • 800-657-3864 • TTY 651-282-5332 or 800-657-3864 • Available in alternative formats wq-strm4-49a • 5/31/13 Page 15 of 15 to establish a training policy and implement it within 12 months of reissuance. F.6. The City will develop a procedure for assessing ponds to determine TSS and TP effectiveness as described in the Permit (Part III.D.6.d) This study will develop procedures for determining TSS and TP treatment effectiveness of city- owned ponds used for treatment of stormwater. A schedule will be implemented in years 2 thru 5. F.7., The City will develop written procedures for inspection of structural stormwater BMPs, ponds and outfalls, and stockpile, storage and material handling areas as described in the Permit (Part III.D.6.f.). Procedures will be in place within 12 months following the date permit coverage is extended. F.8., The City will develop and implement a stormwater management training program commensurate with each employees job duties as described in the Permit (Part III.D.6.g.). Procedures will be in place within 12 months following the date permit coverage is extended. F.8., The City will developwitten procedures to document inspections, mainenance, and training as described in the Permit (Part III.D.6.h.). Procedures will be in place within 12 months following the date permit coverage is extended. 10. Provide the name or the position title of the individual(s) who is responsible for implementing and/or coordinating this MCM: Public Works/Engineering Stafft VI. Compliance Schedule for an Approved Total Maximum Daily Load (TMDL) with an Applicable Waste Load Allocation (WLA) (Part II.D.6.) A. Do you have an approved TMDL with a Waste Load Allocation (WLA) prior to the effective date of the Permit? Yes No 1. If no, continue to section VII. 2. If yes, fill out and attach the MS4 Permit TMDL Attachment Spreadsheet with the following naming convention: MS4NameHere_TMDL. This form is found on the MPCA MS4 website: http://www.pca.state.mn.us/ms4. VII. Alum or Ferric Chloride Phosphorus Treatment Systems (Part II.D.7.) A. Do you own and/or operate any Alum or Ferric Chloride Phosphorus Treatment Systems which are regulated by this Permit (Part III.F.)? Yes No 1. If no, this section requires no further information. 2. If yes, you own and/or operate an Alum or Ferric Chloride Phosphorus Treatment System within your small MS4, then you must submit the Alum or Ferric Chloride Phosphorus Treatment Systems Form supplement to this document, with the following naming convention: MS4NameHere_TreatmentSystem. This form is found on the MPCA MS4 website: http://www.pca.state.mn.us/ms4. VIII. Add any Additional Comments to Describe Your Program CityCouncilAgenda:06/23/14 1 7B.ConsiderationofadoptingResolution#2014-064approvingaleaseagreementwith VerizonWirelessforco-locationonaWirelessTelecommunicationsMonopole,City ProjectNo.ZTOWER (JO/SB) A.REFERENCEANDBACKGROUND VerizonWirelessandCitystaffhavefinalizedtheleaseagreementfortheproposed telecommunicationstowerlocatedatthePublicWorkssite. Thekeytermsoftheleaseagreementareasfollows: VerizontomakerentalpaymentstotheCityintheamountof$24,000peryearfor 10years. Annualrentalwillbeincreasedby3%eachyear. Rentalshallbereducedby$1,800peryear($150permonth)intheeventthat Sprint,T-Mobile,orAT&TleasespaceonthetowerfromtheCity. Theagreementautomaticallyextendsforfouradditionalfive-yeartermsunless VerizonortheCityterminatestheagreementinwriting. CityagreestodiligentlycompleteconstructionofthetowerbySeptember30, 2014. Citytoprovideaccesstothesiteatalltimesforinstallationandmaintenanceof equipment. Thetowerwasre-bid(seeAgendaItem#7C)andre-designedtoa170-footheightto accommodateloadingforthreefuturewirelesscarriersandotherantennauses.The towerwasdesignedtoaccommodateco-locationbyVerizonWirelessata150-foot heightinconjunctionwithapreviouslyapprovedCUPtolocatetheirantennaandshelter ontheproposedtowerandsite.Thetowerwasalsodesignedtoaccommodateloadingfor twootherpotentialfuturecarriersata135-footand165-footheight.Inaddition,the towerwasdesignedforminimalloadingatalowerheightforsectorantennastoprovide locallyimprovedcoverageandloadingforpotentialpublicsafety/emergencyservicesuse (i.e.sirens,whipantennas,camera,repeatertransmittersforXcel). A1.BudgetImpact:TheinitialcostapprovedbythecityCouncilfortheprojectwas upto$300,000usingreservestofundtheprojectupfront.Itisanticipatedthatthe actualtotalprojectcost(constructionandindirectcosts)willbeapproximately $230,000.RevenuewillbegeneratedpertheleaseagreementwithVerizonand potentiallyothercarriersinthefuturethatlocateonthetower. A2.StaffWorkloadImpact:Minimalstafftimewillbespenttoexecutethe agreementandcoordinateleasepayments. B.ALTERNATIVEACTIONS: 1.MotiontoadoptResolution#2014-064approvingaleaseagreementwithVerizon Wirelessforco-locationonaWirelessTelecommunicationsMonopole,City ProjectNo.ZTOWER. CityCouncilAgenda:06/23/14 2 2.MotiondenyingapprovaloftheleaseagreementwithVerizonWirelessatthis time. C.STAFFRECOMMENDATION: StaffrecommendsAlternate#1.TheCityattorneyhasreviewedtheagreementsandhas recommendedapproval. D.SUPPORTINGDATA: A.Resolution#2014-064 B.LetterfromVerizon&TowerLeaseAgreement C.MemorandumofTowerLeaseAgreement CITYOFMONTICELLO WRIGHTCOUNTYMINNESOTA RESOLUTIONNO.2014-064 APPROVINGALEASEAGREEMENTANDMEMORANDUMOFLEASE AGREEMENTWITHVERIZONWIRELESS(VAW)LLC,D/B/AVERIZON WIRELESSFORCO-LOCATIONOFSPACEONA WIRELESSTELECOMMUNICATIONSMONOPOLETOWER CITYPROJECTNO.10C001 WHEREAS,theCityofMonticelloauthorizedadvertisementforbidsforconstructionand erectionofaWirelessTelecommunicationsMonopoleTower,CityProjectNo.10C001on March10th,2014;and WHEREAS,theCityofMonticelloproposestoacceptbidsandenterintoacontractfor constructionanderectionofsaidWirelessTelecommunicationsToweronJune23rd,2014;and WHEREAS,theCityofMonticellodesirestoenterintoaleaseagreementwithVerizon Wirelessforco-locationspaceonsaidWirelessTelecommunicationsTowerinexchangefor paymentstotheCityforaminimumoftenyearswithanautomaticextensionclause. NOWTHEREFOREBEITHEREBYRESOLVEDBYTHECITYCOUNCILOFTHECITY OFMONTICELLO: 1.TheCityshallenterintoanagreementwithVerizonWireless(VAW)LLC,d/b/aVerizon Wireless,toleaseaportionofspaceontheWirelessTelecommunicationsMonopole, CityProjectNo.ZTOWERinaccordancewiththetermsandconditionssetoutinthe TowerLeaseAgreementandMemorandumofTowerLeaseAgreement. 2.TheMayorandCityAdministratorareherebyauthorizedanddirectedtoenterintoa leaseagreementforco-locationspaceforandonbehalfoftheCityofMonticello. ADOPTEDBY theMonticelloCityCouncilthis23rddayofJune,2014. CITYOFMONTICELLO ________________________________ ClintHerbst,Mayor ATTEST: ___________________________________ JeffO’Neill,CityAdministrator CityCouncilAgenda:06/23/14 1 7C.ConsiderationofadoptingResolution#2014-065acceptingbidsandawardingcontract foraWirelessTelecommunicationsMonopole,CityProjectNo.ZTOWER (JO/SB) A.REFERENCEANDBACKGROUND: Thisprojectwasre-bidonApril16,2014fortheconstructionofaproposed170-foot monopolecommunicationstower,withnomicrowavedishloading,locatedonthePublic Workssite.Fivebidswerereceivedwithvaryingbidresultsastheprojectconsistedof severalbidoptionsasdescribedbelow. 1.CompleteTurnkey-Thisbidoptionconsistedofageneralcontractorprovidingthe designandinstallationofthefoundation,electricalgroundgridandfabricationand erectionofthetower. 2.TowerOnly-Thisbidoptionconsistedofacontractortofabricatethetowerand deliverittothesitealongwithprovidingthedesignofthetower,foundationand electricalgroundgrid. 3.ErectionOnly-Thisbidoptionconsistedofacontractorerectingatowerthatis deliveredtothesitealongwithinstallationofthefoundationandelectricalground grid. Theprojectwasbidthiswayinordertoobtaincompetitivebidsastherearecontractors thatonlycompleteasinglecomponentoftheabovework(i.e.eitherfurnishorinstall) andtherearecontractorsthatprovidecompleteturnkeyservices(furnishandinstallthe tower). Thetowerwasdesignedtoa170-footheighttoaccommodateloadingforthreefuture wirelesscarriersandotherantennauses.Thetowerwasdesignedtoaccommodate collocationbyVerizonWirelessata150-footheightinconjunctionwithapreviously approvedCUPtolocatetheirantennaandshelterontheproposedtowerandsite.The towerwasalsodesignedtoaccommodateloadingfortwootherpotentialfuturecarriersat a135-footand165-footheight.Inaddition,thetowerwasdesignedforminimalloading atalowerheightforsectorantennastoprovidelocallyimprovedcoverageandloading forpotentialpublicsafety/emergencyservicesuse(i.e.sirens,whipantennas,camera, repeatertransmittersforXcel). Asnotedabove,fivebidswerereceivedfortheproject.StructuralTowerServicesof Becker,MNsubmittedthelowestresponsiblebidintheamountof$118,933.00forthe completeturnkeybidoption.Asummaryofthebidresultsisattached.Bidsrangedfrom $118,933.00to$268,837.00.Staffhascheckedreferencesandisrecommending awardingthebidtoStructuralTowerServices.Theyhaveconstructedseveraltowersfor MnDOTandHennepinCounty,andtheyhaveprovidedacompetitivebidandarealocal company. ThetowerisbeconstructedbySeptember30,2014.Verizonhassignedtheassociated leaseagreementswhichstipulatethiscompletiondatealongwiththeleaseagreement termsofpayment(seeagendaitem#7B).Permittinghasbeenapprovedfortheproject, CityCouncilAgenda:06/23/14 2 includingFAAandNEPAapproval.VerizonistoobtainFCCapprovalwiththeirpermit forco-location. A1.BudgetImpact:TheinitialcostapprovedbythecityCouncilfortheprojectwas upto$300,000usingreservestofundtheprojectupfront.Itisanticipatedthatthe actualtotalprojectcost(constructionandindirectcosts)willbeapproximately $230,000.Anticipatedcostsfortheconstructionphaseoftheprojectisestimated at$20,000forconstructionmanagement,testingandinspection.PublicWorks willberemovetheexistingtreeonsite,installingthechainlinkfencearoundthe perimeterofthesite,andgravelingthecompound.Revenuewillbegeneratedper theleaseagreementwithVerizonandpotentiallyfromothercarriersthatlocateon thetowerinthefuture. A2.StaffWorkloadImpact:Constructioninspection,concretetesting,and managementoftheprojectwillbecompletedwithacombinationofservicesfrom UlteigEngineering,Design1,WSB,AmericanEngineeringTesting(AET)and theCity’sconstructioninspector. B.ALTERNATIVEACTIONS: 1.MotionadoptingResolution#2014-065acceptingbidsandawardingthecontract tothelowestresponsiblebidder,StructuralTowerServices,intheamountof $118,933.00foraWirelessTelecommunicationsMonopole,CityProjectNo. ZTOWER. 2.MotiondenyingadoptionofResolution#2014-065atthistime. C.STAFFRECOMMENDATION: StaffrecommendsAlternate#1. D.SUPPORTINGDATA: A.Resolution#2014-065 B.BidTabulationResults C.TowerPlans D.PreliminaryConstructionSchedule E.March10,2014CouncilAgendaReportandMinutes F.TowerReturnonInvestmentcalculation CITYOFMONTICELLO WRIGHTCOUNTY,MINNESOTA RESOLUTIONNO.2014-065 ACCEPTINGBIDSANDAWARDINGCONTRACTFORAWIRELESS TELECOMMUNICATIONSMONOPOLE CITYPROJECTNO.ZTOWER WHEREAS,theCityhassolicitedbidsforconstructionand/orerectionofaWirelessTelecom Monopoleaccordingtotheplansandspecificationsprovidedtothepublic.Bidswerereceived, opened,andtabulated,andwerefoundtocomplywithsaidplansandspecifications: BIDITEM TOTALBID($) BID SECURITY (5%)ADDENDUM1CONTRACTOR(X) SABREINDUSTRIES X X X COMPLETETURNKEY TOWERONLY ERECTION $140,693.00 $53,563.00 $91,340.00 X X X X X X STRUCTURAL TOWERSERVICES X COMPLETETURNKEY $118,933.00 X X SIOUXFALLS TOWER X COMPLETETURNKEY $142,791.00 X X VIERTICALLIMIT X COMPLETETURNKEY $153,287.71 X X VINCO X X X COMPLETETURNKEY TOWERONLY ERECTION $268,837.00 $70,886.00 $255,551.00 WHEREAS,thebidsubmittedbyStructuralTowerServices,ofBecker,Minnesota,intheamountof $118,933.00,forthecompleteturnkeyconstructionanderectionforaWirelessTelecomMonopole, CityProjectNo.ZTOWER,inaccordancewiththeplansandspecifications,wasthelowest responsiblebidandshallbeherebyaccepted. NOWTHEREFORE,BEITRESOLVEDBYTHECITYCOUNCILOFMONTICELLO, MINNESOTA: 1.Suchplansandspecifications,acopyofwhichisonfileintheofficeoftheCityClerk,are herebyapproved. 2.Bidssubmittedfortheprojectaccordingtotheplansandspecificationsareherebyaccepted. 3.TheCityAdministratorandMayorareherebyauthorizedanddirectedtoenterintoacontract withsaidcompanyfortheconstructionofsaidimprovementsforandonbehalfoftheCityof Monticello. 4.WSBandtheCityengineeringdepartmentshalldirectandinspecttheprojectwithassistance fromUlteigEngineering,Design1,andAmericanEngineeringTesting(AET). ADOPTEDBY theMonticelloCityCouncilthis23rddayofJune,2014. CITYOFMONTICELLO _________________________________ ClintHerbst,Mayor ATTEST: ________________________________ JeffO’Neill,CityAdministrator Contractor BidItem (CheckOne)TotalBid($)Bid Security(5%)Addendum1 XCOMPLETETURNKEY$140,693.00 X X XTOWERONLY$53,563.00 X X XERECTION$91,340.00 X X XCOMPLETETURNKEY$118,933.00 X X TOWERONLY ERECTION XCOMPLETETURNKEY$142,791.00 X X TOWERONLY ERECTION XCOMPLETETURNKEY$153,287.71 X X TOWERONLY ERECTION XCOMPLETETURNKEY$268,837.00 XTOWERONLY$70,886.00 XERECTION$255,551.00 ENGINEER'SESTIMATE(COMPLETETURNKEY)=$150,000 ShibaniK.Bisson,PE,SeniorProjectManager STRUCTURALTOWER SERVICES VINCO SABREINDUSTRIES SIOUXFALLSTOWER VERTICALLIMIT BIDTABULATIONSUMMARY CITYOFMONTICELLOTOWER WRIGHTCOUNTY,MINNESOTA BIDSOPENED:WEDNESDAY,APRIL16,2014AT4:00PM IherebycertifythatthisisatrueandcorrecttabulationofthebidsasreceivedonApril16,2014. T-1 DO NOT SCALE DRAWINGSDRIVING DIRECTIONS SITE NAME: CITY of MONTICELLO TOWER LOCATION MAP SITE QUALIFICATION PARTICIPANTS SITE INFORMATION DRAWING INDEX TO OBTAIN LOCATION OF PARTICIPANTS UNDERGROUND FACILITIES TOLL FREE: 1-800-252-1166 OR BEFORE YOU DIG IN MINNESOTA, CALL GOPHER STATE ONE CALL FAX A LOCATE: 1-800-236-4967 SITE TYPE: RAWLAND MONOPOLE CODES AND STANDARDS COUNTY HIGHWAY NO. 39 (GOLF COURSE ROAD) 938 937 937 937 9 3 7938 937 936 936 937 938 936 936 936 936 937 B N S F R AIL W A Y (F O R M E R L Y B U R LIN G T O N N O R T H E R N R AIL R O A D A N D A L S O F O R M E R L Y G R E A T N O R T H E R N R AIL R O A D) C-1 COUNTY HIGHWAY NO. 39 (GOLF COURSE ROAD) 938 937 937 937 9 3 7938 937 936 936 937 938 936 936 936 936 937 B N S F R AIL W A Y (F O R M E R L Y B U R LIN G T O N N O R T H E R N R AIL R O A D A N D A L S O F O R M E R L Y G R E A T N O R T H E R N R AIL R O A D) C-2 C-3 B A C-4 G JH D BA C E F A-1 NOTE: CITY CONCRETE SLAB AND GROUND EQUIPMENT NOT SEEN IN THIS ELEVATION G-1 G-2 G JH D BA C E F N-1 A N-2 A N-3 A We e k o f W e e k o f W e e k o f W e e k o f W e e k o f W e e k o f W e e k o f W e ek o f W e e k o f W e e k o f W e e k o f W e e k o f 5/ 2 6 / 2 0 1 4 6 / 2 / 2 0 1 4 6 / 9 / 2 0 1 4 6 / 1 6 / 2 0 1 4 6 / 2 3 / 2 0 1 4 6 / 3 0 / 2 0 1 4 7 / 7 / 2 0 1 4 7 / 1 4 / 2 0 1 4 7 / 2 1 / 2 0 1 4 7 / 2 8 / 2 0 1 4 8 / 4 / 2 0 1 4 8 / 1 1 / 2 0 14 Co n t r a c t Pe r f o r m a n c e B o n d To w e r S u b m i t t a l P k g Bu i l d i n g P e r m i t Pr e - c o n s t r M e e t i n g Si t e P r e p a r a t i o n / E r o s i o n c o n t r o l In s t a l l F o u n d a t i o n s o E x c a v a t e t o w e r f o u n d a t i o n o c o n c r e t e p o u r o 7 d a y c o n c r e t e To w e r o G r o u n d i n g o t o w e r d e l i v e r y o t o w e r a s s y o S t a c k t o w e r Fi n a l W a l k T h r o u g h Ci t y o f M o n t i c e l l o City Council Agenda: 03/10/14 1 7A. Consideration of rejecting bids received and authorizing re-advertisement of bids for a Wireless Telecommunications Monopole, City Project No. ZTOWER (JO/SB) A. REFERENCE AND BACKGROUND Bids were received on January 29, 2014 for the construction of a proposed communications tower located on the public works site. Four bids were received with varying bid results as the project consisted of several bid options as described below and as shown in the enclosed documents. 1. Complete Turnkey - This bid option consisted of a general contractor providing the design and installation of the foundation, electrical ground grid and fabrication and erection of the tower. 2. Tower Only - This bid option consisted of a contractor to fabricate the tower and deliver it to the site along with providing the design of the tower, foundation and electrical ground grid. 3. Erection Only - This bid option consisted of a contractor erecting a tower that is delivered to the site along with installation of the foundation and electrical ground grid. The project was bid this way in order to obtain competitive bids as there are contractors that only complete a single component of the above work (i.e. either furnish or install) and there are contractors that provide complete turnkey services (furnish and install the tower). The project also consisted of different loading bid options for the tower (i.e. loading for one wireless carrier, two carriers and three carriers) and the inclusion of loading for future microwave dishes to serve Fibernet. The tower was designed to a 199-foot height to accommodate loading of an antenna by Verizon Wireless at 150-feet in conjunction with a lease agreement and previously approved CUP to locate their antenna and shelter on the proposed tower and site. The tower was also designed to accommodate loading for two other potential future carriers at a 135-foot and 165-foot height. In addition, the tower was designed for minimal loading at a lower height for sector antennas to provide locally improved coverage and loading for potential public safety/emergency services use (i.e. sirens, whip antennas, camera, repeater transmitters for Xcel). Three 3-foot and one 6-foot microwave dishes, at varying radio frequencies located at a 190-foot centerline height, were also included in the loading design and bid options with the intent that these microwave dishes would potentially service other areas outside the City limits as a backhaul to fiber service if there is ever a need for this in the future. In total, there were 36 different bid pricing options to consider and narrow down to one bid option that would be the best value for the City, with the objective of gauging what the current and future needs are for Fibernet. Another consideration was the cost/benefit of each option as revenue would be generated from leasing the tower for other wireless carriers to co-locate. The different bid results allowed us to see what the incremental cost City Council Agenda: 03/10/14 2 would be for loading for one to three wireless carriers and the cost for inclusion of loading for the 6-foot microwave dish. A description of the bids results are as follows: Structural Tower Services (Becker, MN) bid the Complete Turnkey only. Bids varied from approximately $160,000 to $242,000 depending on the bid option. Sabre Industries, Inc. (Sioux City, IA) bid for the Complete Turnkey varied from approximately $165,000 to $251,000 depending on the bid option. They also supplied bids for the Tower Only and Erection Only options; however, the Erection Only bid is not valid since the pricing did not include the foundation and electrical ground grid installation. .Rohn Products (Peoria, IL) supplied a bid for the Tower Only for Load Option #3 (three wireless loading) w/ 6”MW Dish- 5ghz at a price of $69,330. Sioux Falls Tower (Sioux Falls, SD) submitted a bid for $107,243 for Erection Only for all bid options; however, they indicated that their bid price is an estimate pending final foundation design by the tower manufacturer. Therefore, this is not considered a valid bid. The low bid to construct a tower to accommodate three wireless carriers loading and also included loading for the 3-foot microwave dishes was approximately $190,000. Providing a tower to accommodate loading for three wireless carriers was the initial intent of the project and the incremental cost compared to accommodating loading for one or two wireless carriers is not substantial, given the potential revenue that could be generated over the long term from these future carriers. The higher end of the bids received ($230,000 to $240,000) for the Complete Turnkey bid is due to the large loading for the microwave dishes. After reviewing the bids, and in our discussions, it became apparent that another option exists to locate the microwave dishes on the city’s water towers instead of at the top of the proposed tower, which would thereby reduce the height and cost of the proposed tower. The top elevation of the city’s water towers, located adjacent to the Monte Club Hill and south of School Boulevard, are at the same elevation as the proposed 199-foot communications tower at the public works site. It was therefore concluded that the microwave dishes, if ever needed in the future, should be located at the city’s water towers since the elevation is the same and the water tower can support such a load. Given this scenario, the tower can be designed shorter (approximately 170 feet instead of 199 feet). We estimate this would result in a cost of $150,000 instead of $190,000 to $250,000 to construct the tower with all microwave dish loading (3-foot and 6-foot dishes). This option should be considered since the bid results were very high, and outside of the initial budget of $200,000, for including the microwave dish loads on the proposed tower. This option makes sense due to the height needed and the fact that the City already has the height and elevation needed in their existing water towers. Reducing the height and City Council Agenda: 03/10/14 3 cost of the proposed tower is a feasible option and likely the best value for the City given the uncertainty for the need of the microwave dishes, which if determined needed, can be placed on a water tower in the future. Given all the information above, staff is recommending that all bids be rejected and the project be re-bid with the tower designed and constructed to an approximate 170-foot height to accommodate three wireless carrier loads along with associated sector antennas and siren/whip antennae loadings. If approved, the project is proposed to be bid in early April with consideration of award to be brought to the Council at the April 14, 2014 meeting. The tower would be constructed by late July. Staff had spoken with Verizon’s representative and they are in agreement with a completion date of July 31, 2014. The lease agreement will not be ready for execution until the April 14, 2014 Council meeting anyway, due to delays on Verizon’s end with survey work and legal description revisions for their electrical service and shelter orientation on the site. A1. Budget Impact: The initial cost approved by the city Council for the project was up to $300,000 using reserves to fund the project up front. It is anticipated that the actual project cost will be under this amount. Revenue will be generated per the lease agreement with Verizon and potentially other carriers in the future that locate on the tower. A2. Staff Workload Impact: Ulteig and WSB staff will prepare the revised plans and specifications and re-bid the project for an estimate fee of $5,000 to $10,000, which will ultimately be incorporated into the total project costs. B. ALTERNATIVE ACTIONS 1. Motion to reject bids received and authorize re-advertisement of bids for a Wireless Telecommunications Monopole, City Project No. ZTOWER. 2. Motion of other. C. STAFF RECOMMENDATION Staff recommends Alternate #1. Rejecting all bids and re-advertising the project to reduce the height and cost of the proposed tower is a feasible option and likely the best value for the City given the uncertainty for the need of the microwave dishes. If need for microwave dishes is determined, they can be placed on a water tower in the future. Further, the need to support other governmental or civil defense communication functions can be achieved on a lower tower. Although having the extra height for the microwave dishes might be useful in the future to support a potential communication use, it may not be worth spending an additional minimum of $30,000 on this speculation. D. SUPPORTING DATA Current Tower Drawings Date:6/19/2014 CommunicationsTower 6/19/2013 Cost/Revenue Accumulative YearOutgoingCashIncomingCashNetCash(Payback) 0230,000$-$(230,000)$(230,000)$ 13,60024,00020,400(209,600) 23,70824,72021,012(188,588) 33,81925,46221,642(166,946) 43,93426,22522,292(144,654) 54,05227,01222,960(121,694) 64,17327,82323,649(98,044) 7 4,299 28,657 24,359 (73,686) 84,42829,51725,089(48,596) 94,56030,40225,842(22,754)Loss 104,69731,31526,617 3,863 Gain 114,83832,25427,416 31,279 124,98333,22228,238 59,517 135,13334,21829,086 88,603 145,28735,24529,958 118,561 155,44536,30230,857 149,418 ROI(Year15)296,956446,374150.3% Payback-shadedarea CalculationTable DiscountRates LowerDiscountRate3.0% HigherDiscountRate7.0% PresentValueatLowerDiscountRate 297,087 NetPresentValueatLowerDiscountRate 67,087 PresentValueatHigherDiscountRate 222,014 NetPresentValueatHigherDiscountRate (7,986) InternalRateofReturn 10years 0.3% InternalRateofReturn 15Years 6.5% ProfitabilityIndexatLowerDiscountRate 1.29 ProfitabilityIndexatHigherDiscountRate 0.97 CityCouncilAgenda:06/23/14 1 7D.ConsiderationofAnalysisrelatedtoInterimOrdinance#590,aninterimordinance allowingPlacesofPublicAssemblyonatemporarybasisasaprincipaloraccessory useinaB-3HighwayBusiness)District (NAC/AS) A.REFERENCE&BACKGROUND: Request(s):Inresponse totheCity’srecentestablishmentofaninterim ordinanceassociatedwiththetemporaryallowanceof“Placesof PublicAssembly”withinB-3(HighwayBusiness)Districts, relatedbackgroundinformationhasbeenassembledfortheCity Council’sconsideration. ANALYSIS InterimOrdinanceAmendment.Thisspring,theCityCouncilapprovedaninterim ordinancetoallow“placesofpublicassembly”onatemporarybasis(asaprincipalor accessoryuse)inB-3,HighwayBusinessDistrictsbyinterimusepermit.Inconjunction withsuchapproval,theCityCouncilalsoapprovedaspecificinterimusepermittoallow “aplaceofpublicassembly”(FaithFamilyLifeCenter)ontheformerCornerstone Chevroletpropertylocatedat3939ChelseaRoadWest. Thepurposeofaninterimordinanceistoallowamunicipalitytoputtemporarystandards inplaceapplicabletoallorpartofitsjurisdictionforthepurposeofprotectingthe planningprocessandthehealth,safetyandwelfareofitscitizens(MS§462.355Subd.4). Withinthedurationoftheinterimordinance,theCitymustalsoinitiateastudyto evaluatethepotentialimpactofapolicytoconsiderchangestoitslandusecontrols. AnexaminationoftheCity’sexistingregulationof“placesofpublicassembly”is consideredanappropriatenextstepinregardtoanevaluationoftheuse. “PlaceofPublicAssembly”Definition.TheCity’sZoningOrdinancedefinesa“place ofpublicassembly”asfollows: Aninstitutionorfacilitythatcongregationsofpeopleregularlyattendto participateinorholdmeetings,workshops,lectures,civicactivities,religious services,andothersimilaractivities,includingbuildingsinwhichsuchfunctions andactivitiesareheld. Theprecedingdefinitionincludeschurches,fraternallodges,andsocialclubs. Tobenotedisthattheprecedingdefinitiondoesnotinclude“motionpicturetheaters.” Rather,“motionpicturetheaters”areconsideredatypeof“indoorcommercial entertainment”asdefinedintheOrdinance. CityCouncilAgenda:06/23/14 2 ComprehensivePlan.TheLandUsePlan,asincludedintheCity’s2008 ComprehensivePlan,depictsseriesof“places”forprivatedevelopment.Theseinclude “PlacestoLive”,“PlacestoShop”,“PlacestoWork”,and“Downtown.” A“placeofpublicassembly”isauniqueuseinthatitisnotnecessarilyaplacetolive, shoporwork. TheComprehensivePlandoeshowever,makereferenceto“PlacesforCommunity” whichappearstoinclude“placesofpublicassembly”fromalanduseperspective. AccordingtothePlan,“PlacesforCommunity”includepublicandsemi-publiclanduses. Publicusesincludeallgovernmentalfacilitiesandschools.Thecategoryalsoincludes churches,cemeteries,hospitalsandotherinstitutionaluses. TobenotedisthattheComprehensivePlandoesnotguidethelocationofnewchurches, schoolspublicbuildings,andotherinstitutionaluses.However,thePlannotesthatnew “PlacesforCommunity”willbeneededinthenorthwestareaoftheCityasitdevelops. ThePlanalsonotesthatnewinstitutionalusesshouldbeallowedinresidentialareas undercertainconditions.Inthisregard,aspectsofproposedinstitutionalusesrelatedto thefollowingmustbeconsidered: Size/scaleofdevelopmentinrelationtothesurroundingneighborhood. Parkingimpactsuponsurroundingresidentialareas. Trafficimpacts. Lightingandsignageshouldbecompatiblewithsurroundingresidentialareas. DistrictAllowance.“Placesofpublicassembly”,asdefinedbytheZoningOrdinance, arepresentlyallowedwithintheCityasfollows: ZoningDistrictDistrictPurposeDistrictAllowance R-1,SingleFamily Residence Toprovideforlowdensity,single family,detachedresidentialdwelling unitsanddirectlyrelated complementaryuses. ConditionalUse R-2,SingleandTwo FamilyResidence Toprovideforlowtomoderatedensity oneandtwounitdwellingsand directlyrelatedcomplementaryuses. ConditionalUse TN,Traditional NeighborhoodResidence Toprovideformedium density,single family,detachedresidentialdwelling unitsanddirectlyrelated complementaryuses. ConditionalUse R-4,Medium-High DensityResidence Toprovideformediumtohighdensity housinginmultiplefamilystructures of13ormoreunitsperbuilding,andat densitiesofbetween10and25units peracre. ConditionalUse B-2,LimitedBusiness Toprovideforlowintensityretailor serviceoutletswhichdealdirectlywith PermittedUse CityCouncilAgenda:06/23/14 3 thecustomerforwhomthegoodsor servicesarefurnished. CCD,Central CommunityDistrict Toprovideforawidevarietyofland uses,transportationoptions,andpublic activitiesinthedowntownMonticello area,andparticularlytoimplementthe goals,objectives,andspecific directivesoftheComprehensivePlan, andinparticular,theEmbracing DowntownMonticelloreportandits DesignGuidelines. ConditionalUse,all sub-districts B-3,HighwayBusiness Toprovideforlimitedcommercialand serviceactivitiesandprovideforand limittheestablishmentofmotor vehicleorientedordependent commercialandserviceactivities. InterimUse(per recentlyapproved amendment) PerformanceStandards.Section5.2oftheZoningOrdinanceestablishesasetof performancestandardswhicharespecifictoall“placesofpublicassembly”withinthe City.Theseconditions,asreiteratedbelow,aretobeappliedinadditiontobasicgeneral provisionsanddistrictstandards. 1.Institutionsonparcelsexceeding20,000squarefeetinareashallbelocatedwith directfrontageon,andaccessto,acollectororarterialstreet. 2.Thebuildingsaresetbackfromadjoiningresidentialdistrictsadistancenoless thandoubletheadjoiningresidentialsetback. 3.Whenabuttingaresidentialuseinaresidentialusedistrict,thepropertyshallbe screenedwithanaestheticbuffer(Table4-2,BufferType“B”)inaccordancewith section4.1(G)oftheOrdinance. 4.Adequateoff-streetparkingandaccessisprovidedonthesiteoronlotsdirectly abuttingordirectlyacrossapublicstreetoralleytotheprincipalusein compliancewithSection4.8ofthisordinanceandthatsuchparkingisadequately screenedandlandscapedfromsurroundingandabuttingresidentialusesin compliancewithSection4.1(F)oftheOrdinance. 5.Adequateoff-streetloadingandserviceentrancesareconsideredand satisfactorilyprovided. Thereareacoupleofcategoriesofissuesraisedbytheinterimuserequest.Theseare summarizedbelow,withstaffcommentsincluded. 1.AprimarypurposeoftheCity’sZoningOrdinanceistoimplementthelanduse directivesoftheCity’sComprehensivePlan.Thus,aprimaryquestiontobe answerediswhetherornotthecurrentComprehensivePlanpoliciesrelatedto “placesofpublicassembly”remainapplicable.Recognizingthat“placesof CityCouncilAgenda:06/23/14 4 publicassembly”arenotspecificallyreferencedinthePlan,thefollowing questionsareraised: a.Are“placesofpublicassembly”clearlyasubsetof“placesfor community”asreferencedinthePlanandthussubjecttothesameland usedirectives? StaffComment:OneoftheaspectsofthecodeisapplicationofPlan goalstospecificordinanceallowances.Theordinanceseemstodefine PublicAssemblyaswhatwemighttypicallythinkofasaninstitutional use,thenincludesitzonesoutsideofthelandusecategory(Placesfor Community)inwhichitwouldlogicallybelocated.Thepurposeofthis wastheidentificationoftheCCDandB-2Districtasdistrictsinwhich community-basedserviceswouldbeoffered,withanunderstandingthat thoseserviceswouldbeprimarilytolocalresidentsorbusinesses.TheB- 3District,ontheotherhand,isdesignedtoserve,inlargepart,the travelingpublic.Assuch,theB-3Districtwasnotincludedasapotential locationfor“PlacesofPublicAssembly”. b.IsthenorthwestareaoftheCitystillatargetareafornew“placesfor community”which,byunderstoodassociation,includes“placesofpublic assembly?” StaffComment:Certainly,thenorthwestareaofthecityincludesthe BertramLakesparkarea,animportant,ifnotdominant,“placefor community”.Iftheparkuseconstitutestheextentofcommunitylanduses inthearea,thelandusedesignationcouldbeseenasmuddlingthat somewhat.Greaterdefinitioninthelanduseplanmighthelptoaddress this.Thatsaid,otherinstitutionalusesaretypicallysitedonacase-by- casebasis,respondingtospecificrequests.ThePlananticipatesfuture placesforcommunityinthenorthwest,butdoesnotsitethem. 2.IfnochangestothecurrentComprehensivePlanpolicesaredesired,question existswhetherornotthecurrentprovisionsoftheZoningOrdinanceadequately implementthePlan’slandusedirectivesrelatedto“placesofpublicassembly.” Inthisregard,thefollowingquestionsareconsideredworthyofdiscussion: a.Should“placesofpublicassembly”,regardlessofscale,beallowedin residentialzoningdistricts? StaffComment:Theironyofmanycontemporaryreligiousinstitutional usesisadesireforhigh-exposure,high-accessproperty,withalanduse patternthatdiffersfromcommercialbusinessesthatusuallypopulate theseareas.Atthesametime,churchdevelopmenthasevolvedtobe muchmorethanwhenchurcheswerecommonlylocatedinthemidstof residentialneighborhoods.Thefactisthatchurchesandsimilar CityCouncilAgenda:06/23/14 5 institutionaluseshavelandusecharacteristicsthatareneithercompatible withmostsmaller-scaleneighborhoods,norsimilartocommercialuses. Thezoningordinanceuseoftheterm“publicassembly”couldbebetter definedinthisregard.However,sitingchurchusesinresidentialareasis socommon,itisoftensimplertoincludetheseusesinresidentialzoning districts,preparingspecialrequirementsforthemthatdon’tapplyto actualresidentialdevelopment.Monticello’sordinanceisstructuredin thisway,anditcanbeacomplexmattertorestructurethecodetoaddress thissingleissue.Thenegativewiththisapproachisthatlarge-scale churchusesareallowedasamatterofrightinneighborhoodsthatmight otherwiseobjecttothelevelsofactivitythatsomechurchesgenerate. b.Are“placesofpublicassembly”anappropriatealloweduseintheCity’s CCDandB-3,HighwayBusinessDistrict?Ifso,isthepresentallowance viainterimusepermitappropriate? StaffComment:ThisisthecruxofthequestionrelatingtotheCity’s interimordinance.CurrentlyallowedaspermittedusesintheB-2district andconditionalusesintheCCD,itappearsthatthisinclusionisintended toaddressthecommunity’sneedforplacesofpublicassembly,while recognizingthatresidentiallyzonedpropertiesmaynotbeableto adequatelyaccommodatepublicassemblyintermsofsitedesignandsize. Asnotedabove,manychurchesaremorelikelytoseekhigh-profile commercialsitesthantheB-2andCCD.ThequestionfortheCityis whethertheseusesareconsideredappropriateinthesehigher-profilesites andspecificallyintheB-3Districtgivenitspurposetoprovideforand limittheestablishmentofmotorvehicleorientedordependentcommercial andserviceactivities. c.Aretheperformancestandardsspecificallyrelatedto“placesofpublic assembly”consideredadequateareorsomechangesdesired? StaffComment:Thepresumptionhereisthatthecurrentstandardsare appropriate,andthatinstead,thequestioniswhetherausewiththese characteristicsshouldbeallowedpermanentlyintheB-3District. d.Shouldthedefinitionof“placeofpublicassembly”bemodifiedtonote that“indoorcommercialentertainment”(e.g.motionpicturetheaters)is notforthepurposesoftheOrdinance,considereda“placeofpublic assembly?” Staffcomment:Ifmorepermanentchangestotheordinancearetobe considered,definitionsshouldalsobeaddressed.IftheCityissatisfied withthecurrentlandusepatternandzoningarrangement,thedefinitions areprobablyadequate. CityCouncilAgenda:06/23/14 6 SUMMARY Priortothecurrentzoningordinance,theCityutilizedaspecializedzoningdistrictfor institutionaluses,includingreligiousinstitutions.Atonepoint,aconcernaroseinthe zoninglawrealmastowhethercitieswouldberequiredtoaccommodatechurch assemblyusesanywherethatcommercialassemblyusesareallowed.Thisconcernwas basedinacoupleoffederallaws(“RFRA”-theReligiousFreedomRestorationAct;and “RLUIPA”–theReligiousLandUseandInstitutionalizedPersonsAct),alongwitha coupleofprominentlegalchallengesinthefederalcourts. Theessentialthrustofthesefederalactionswasaclarificationthatazoningauthority couldnotdiscriminateagainstaparticularlandusemerelyonthebasisofthefactthatthe landusewasreligiousinnature.Themostcommonlyappliedexampleofthisprinciple usedamovietheaterandatraditionalchurchuse.Itwasproposedthatsincebothuses haveamainassemblyhallarea,whereacityallowedtheatres,itmustalsoallow churches.Asaresult,manyordinanceswerewrittentoinclude“publicassembly”asa landuse,andthenincorporatingitintowherevermovietheatreswereallowed. InMonticello’sordinance,however,thedistinctionwasessentiallyfocusedonthe perceivedserviceareaofthefacility.Asaresult,theordinancewasconstructedtoallow churchusesinresidentialareasastheytraditionallyhavebeen,andtoincorporatethem intolimitedcommercialdistricts–thosedesignedtoservelocalmembersofthe communityasopposedtoamoreregionalfocus. Thus,therealquestionfortheCity,relatedtotheinterimordinance,iswhethertheB-3 Districtshouldbeincludedasaneligiblelocationforpublicassemblyusesasdefined. Historically,theCityhasbeenreluctanttoremovelandfromitsavailablestockof potentialbusinesslocations.Makingachangesuchasthiswouldpotentiallyreduce availablecommerciallandassumingthatsomeoftheexistingproperty(includingthe parcelsubjecttothecurrentIUP)wouldbeconvertedtopublicassemblyuse,ratherthan amoretraditionalauto-relatedcommercialdevelopment. Insummary,thecurrentordinanceappearstoadequatelyservetheintentofthe ComprehensivePlaninfocusingonthegroupsofpopulationsbeingserved.Adding PlacesofPublicAssemblytotheB-3District,andexpandingthisusetoaregionally- focusedlandusecategorywouldbeinconsistentwiththeCity’soriginalplanning approach,sincesuchachangewouldexpandthepotentialsitingforsuchusestomuchof theHighway25corridor(ascurrentlyzoned). PLANNINGCOMMISSIONREVIEWANDRECOMMENDATION ThePlanningCommissionreviewedthestudyanalysisduringtheirregularmeetingon June3rd,2014. CityCouncilAgenda:06/23/14 7 IntheCommission’sdiscussion,itwasnotedthattherearecurrentlynumerouszoning districtswithinthecodewhichallow“placesofpublicassembly”aspermittedor conditionaluses,includingtheB-2(LimitedBusiness)districtandCCD. PlannerSteveGrittmannotedtotheCommissioninhisreportthatiftheCitywas inclinedtomovebacktowardsaspecificPublic/Semi-Publiczoningdistrictoroverlay districtforusessuchasplaceofpublicassemblyorschools,theCitywouldthenlikely needtorezonepropertiestoaccommodatethelocationofnewfacilities. CommissionerFyleinquirediftheordinancewereallowedtolapse,whethertheCity couldreconsiderotheractionatafuturetime.GrittmanconfirmedthatCitycouldre- evaluatezoningactionsoramendmentsrelatedtotheseusesinthefuture. CommissionerGableraskedwhatthecity’soptionswouldbetoallowpublicassembly usesintheB-3districts.GrittmanrespondedthatiftheCitydecidedtoallowtheusein theB-3District,theCitywouldthenhavetheabilitytoallowtheuseaspermitted, conditional,orbyinterimuse.Gablerstatedthatshethoughttheplaceofpublic assemblyusecouldbeallowedintheB-3,butshouldrequireaconditionalusepermitto allowtheCityprovisionforreview.Herpreferencewouldbetoallowtheuseby conditionalusepermitintheB-3. CommissionerBurveerequestedconfirmationthatifnoactiontoamendtheordinance wastaken,theinterimuseordinancewouldexpire.Grittmanagreed. Astheitemwasnotapublichearing,nopublictestimonywastaken. CommissionerFylemotionedtodenycallingforahearing.CommissionerBurvee secondedthemotion.Themotionpassed3-1,withCommissionerGablerdissenting. B.ALTERNATIVEACTIONS: 1.Motiontocallforapublichearingtoconsideramendmentstothezoning ordinanceestablishing“PlacesofPublicAssembly”asapermanentlanduse categoryoptionintheB-3ZoningDistrict. 2.Motiontodenycallingforpublichearingontheamendment,permittingthe currentinterimordinancetoexpireattheendofAugust,2014,andtodirect preparationofaresolutionoffindings. C.STAFFRECOMMENDATION: IftheCityissatisfiedwiththecurrentlandusepattern,therewouldbenonecessityto changetheordinance.Thecurrentinterimordinancewouldexpire,aswouldtheIUPin August. CityCouncilAgenda:06/23/14 8 IftheCitybelievesthatabroaderallowanceforpublicassemblyusesisappropriate, therearetwobasicoptions: 1.Amendthezoningordinancetoaddpublicassemblyusesinotherdistricts,such astheB-3.Withthisalternative,therearesomechangestodefinitionsandother standardsrequirementsthatwouldbeappropriate. 2.Reconsiderazoningdistrictthatcatersspecificallytoinstitutionaluses,suchas schools,religiousassemblyuses,andpublicactivities. 3.Considerchangingzoningdesignationsforappropriateinstitutionaluseparcelsto residential,orperhapsB-2,ifsuchparcelsareproperlylocatedtomeettheintent ofthezoningdistrict.Thiscouldbedoneonacase-by-casebasisattherequestof individualpropertyowners. Staffdoesnotrecommendthepermanentamendmentasrelatedtotheinterimordinance. Thestructureofthezoningordinanceissetuptocreatevariouslandusedistrictsbased generallyontheintendedservicepopulation.Theordinance,andtheComprehensive Plan,treatsinstitutionalusesasthosethatfocustheirservicesprimarilyonthelocal community.Assuch,theinclusionof“PlacesofPublicAssembly”intheB-2District andCCDastheonlycommercialaccommodationforsuchusesissensible.Including suchusesintheB-3districtwouldaltertheCity’sintentinthedesignofitsordinance andotherplanningregulations. D.SUPPORTINGDATA: A.InterimOrdinance#590 B.ExcerptfromMonticelloComprehensivePlan,Chapter3-PlacesforCommunity C.MonticelloZoningOrdinance,Excerpts: 5.1-UseTable 5.2(D)(8)–RegulationsforCivic&InstitutionalUses:PlacesofPublic Assembly 8.4-Definitions Land Use | 3-152008 Comprehensive Plan ~ Updated 2013 f Applicable traffic safety and access requirements limit the ability to comply with building location standards of this Plan. f At least fifty (50) percent of either the Broadway or Pine Street frontage is occupied by a building (non-parking area). f An alternative vertical element is located at the street corner. This element must be determined by City Officials to establish an architecturally compatible corner presence. Such elements may include, but not be limited to public art, interpretive signage, architectural business signs, and architecturally appropriate lighting. Mixed Use The Mixed Use is a transition area between the Downtown and the hospital campus. It has been created in recognition of the unique nature of this area. The area serves two functions. It is the edge between long-term residential neighborhoods and a major transportation corridor (Broadway Street). It is also a link between the Downtown, the hospital campus and the east interchange retail area. The primary goal of this land use is to preserve and enhance housing in this part of Monticello. Any non-residential development should be designed to minimize the impacts on and conflicts with adjacent neighborhoods. Policies - Mixed Use 1. Development should not have direct access to Broadway street. Access should come from side street. 2. Non-residential development should be limited to small retail, service and office businesses. The scale, character and site design should be compatible with the adjacent residential neighborhoods. 3. All non-residential development will be oriented to Broadway Street and not to 3rd Street or River Street. 4. Commercial development compatible with the Downtown should be encouraged to locate there. 5. More intense housing and commercial uses may be allowed if directly related to the hospital. Places to Recreate Places to Recreate consist of public parks and private recreation facilities. The land uses are essential elements of the quality of life in Monticello. The Parks and Trails chapter of the Comprehensive Plan describes the current park and trail system and the future plan to maintain and enhance this system. The Comprehensive Plan is only one aspect of managing the land use for public parks and private recreation facilities. The City’s zoning regulations place these locations into a zoning district. Often, the purpose of the zoning district is to guide private development, such as housing. Under current State Law, zoning regulations “trump” the Land Use Plan and govern the use of land. With the potential for the redevelopment of golf courses, it is important the Comprehensive Plan and other land use controls work in concert to achieve the desired outcomes. The City’s plans and policies for parks, trails and open space can be found in the Parks chapter of the Comprehensive Plan Places for Community Places for Community consist of public and semi- public land uses. Public uses include all governmental facilities (city, county, state and federal) and schools. This category also applies to churches, cemeteries, hospitals, and other institutional uses. It is important to note that these land uses relate only to existing land uses. The Comprehensive Plan does not guide the location of new churches, schools, public buildings and other institutional land uses. Places for Community will be needed in the Northwest area as it develops. These uses are typically allowed in residential areas and governed by zoning regulations. These institutional uses (such as schools and churches) are important parts of the fabric of the community, but require guidance to ensure a proper fit with its residential surroundings. New institutional use should be allowed in residential areas under certain conditions. These conditions should address the aspects of the use that conflict with 3-16 | Land Use City of Monticello desired characteristics of residential neighborhood. Criteria for locating an institutional use in a residential land use area include: 1. Size. Large buildings and site areas can disrupt neighborhood cohesiveness. Use in lower density residential areas should not be more than [to be determined] square feet in lot area. 2. Parking. Parking may spill on to neighborhood streets without adequate on-site facilities. The parking needs will vary with the use of the facility. Each facility should provide adequate on-site or reasonable off-site shared parking based on the use of the facility. 3. Traffic. Institutional uses should be oriented to designated collector or arterial streets. 4. Lighting and signage. Site lighting and signage needs may resemble commercial uses. These site factors should be managed to fit the character of the surrounding residential development. Urban Reserve The Urban Reserve contains all property in the Orderly Annexation Area that it not shown for development in the near term in this Plan. The objective is to encourage rural and agricultural uses, preventing barriers to future development opportunities. It is anticipated that the City will grow into portions of the Urban Reserve as planned land use areas become fully developed and capacity for future growth in needed. The Urban Reserve is not simply a holding area for future development. Parts of the Urban Reserve are likely to be preserved as natural resource areas or for agricultural purposes. Future planning will consider the locations in the Urban Reserve best suited for development. Interchange Planning Area The Interchange Planning Area encompasses undeveloped land in the northwest part of Monticello around the site of a potential west interchange with Interstate 94. The purpose of this land use is to preserve the area for future development and prevent the creation of development barriers. If built, the area should be planned to support a mixture of commercial, employment and residential land uses. The interchange location and the routes of future connecting roads are solely for illustration. Future land use issues in this area are discussed in the Focus Area for Northwest Monticello. Private Infrastructure This category applies to Xcel Energy’s power plant and railroad right-of-way. This category recognizes the unique role of the power plant in Monticello. Greenway The Land Use Plan Map shows a “potential greenway” ringing the western and southern edges of Monticello. The Greenway is intended to provide an environmental corridor that connects large community parks and open spaces to neighborhoods, schools, shopping areas and places to work. They serve to protect environmentally sensitive areas such as natural habitat, wetlands, tree canopy, and drainage ways. Land within this corridor could be comprised of a combination of public and private open space. Development would not be prohibited within the greenway but would be reasonably restricted to ensure that development is carefully integrated with the natural environment. The Greenway is intended to shape development patterns in a manner that is sensitive to the existing environment and harmonious with the landscape. The Greenway creates opportunities for a continuous trail corridor connecting neighborhoods with large parks and open spaces. A trail within this corridor is intended to be fully accessible to the general public. The following are the City’s goals for the Greenway: 1. To provide (where possible) a continuous green corridor connecting large community parks and open spaces to neighborhoods, shopping areas, schools and places to work. 2. To connect people to significant places. 3. To protect the community’s natural resources (trees, ponds, wetlands, slopes, etc). 4. To create environmentally sensitive development and design. CHAPTER 5: USE STANDARDS Section 5.1 Use Table Subsection (A) Explanation of Use Table Structure Page 312 City of Monticello Zoning Ordinance (c) Interim Permitted Uses = I An “I” indicates that a use may be permitted for a brief period of time provided certain conditions are met, and a specific event or date can be established for discontinuance of the use. Inability of the City ]o establish conditions to adequately control anticipated impacts is justification for denial of an interim permitted use. Interim Permitted Uses may also be subject to special regulations as referenced in the “Additional Requirements” column. (d) Prohibited Uses = Shaded Cells A shaded cell indicates that the listed use is prohibited in the respective base zoning district. (e) Unlisted Uses If an application is submitted for a use that is not listed in Table 5-1, the Community Development Department is authorized to classify the new or unlisted use into an existing Use Type that most closely fits the new or unlisted use. If no similar use determination can be made, the use will be considered prohibited in which case an amendment to the ordinance text would need to be initiated to clarify if, where, and how a proposed use could be established. TABLE 5-1: USES BY DISTRICT Use Types “P” = Permitted “C” = Conditionally Permitted “I” = Interim Permitted Base Zoning Districts Additional Requirements A O R A R 1 R 2 T N R 3 R 4 M H B 1 B 2 B 3 B 4 C C D I B C I 1 I 2 Agricultural Uses Agriculture P P P P P P P P P P P P *SE E T A B L E 5 -1A P P P 5.2(B)(1) Agricultural Sales P 5.2(B)(2) Community Gardens P P P P P P P P P 5.2(B)(3) Stables C 5.2(B)(4) CHAPTER 5: USE STANDARDS Section 5.1 Use Table Subsection (A) Explanation of Use Table Structure City of Monticello Zoning Ordinance Page 313 TABLE 5-1: USES BY DISTRICT (cont.) Use Types “P” = Permitted “C” = Conditionally Permitted “I” = Interim Permitted Base Zoning Districts Additional Requirements A O R A R 1 R 2 T N R 3 R 4 M H B 1 B 2 B 3 B 4 C C D I B C I 1 I 2 Residential Uses 5.2(C)(1) Attached Dwelling Types 5.2(C)(2)(a) - Duplex P C *SE E T A B L E 5-1A 5.2(C)(2)(b) - Townhouse C P 5.2(C)(2)(c) - Multiple-Family C P C C 5.2(C)(2)(d) Detached Dwelling P P P P P P None Group Residential Facility, Single Family P P P P P 5.2(C)(3) Group Residential Facility, Multi-Family C C C 5.2(C)(3) Mobile & Manufactured Home / Home Park C C C P C 5.2(C)(4) Civic & Institutional Uses Active Park Facilities (public) P P P P P P P P P P P P *SE E T A B L E 5-1A P P P None Active Park Facilities (private) P P P P P P P 5.2(D)(1) Assisted Living Facilities C P C 5.2(D)(2) Cemeteries C C C C C C C 5.2(D)(3) Clinics/Medical Services C P P C None Essential Services P P P P P P P P P P P P P P P None Hospitals C P P C 5.2(D)(4) Nursing/Convalescent Home C C C C C C C C C P P 5.2(D)(5) Passenger Terminal C C C C None Passive Parks and Open Space P P P P P P P P P P P P P P P None Public Buildings or Uses C C C C C C C P C C P P C P P 5.2(D)(6) Schools, K-12 C C C C C C I I 5.2(D)(7) Schools, Higher Education C None Place of Public Assembly C C C C C P 5.2(D)(8) Utilities (major) C C C C C C C C C C C C C C C 5.2(D)(9) Office Uses Offices P P C P * P P P 5.2(E) CHAPTER 5: USE STANDARDS Section 5.1 Use Table Subsection (A) Explanation of Use Table Structure Page 314 City of Monticello Zoning Ordinance TABLE 5-1: USES BY DISTRICT (cont.) Use Types “P” = Permitted “C” = Conditionally Permitted “I” = Interim Permitted Base Zoning Districts Additional Requirements A O R A R 1 R 2 T N R 3 R 4 M H B 1 B 2 B 3 B 4 C C D I B C I 1 I 2 Commercial Uses Adult Uses *SE E T A B L E 5-1A P P 3.7(K) Auction House C 5.2(F)(2) Auto Repair – Minor C C P P 5.2(F)(3) Automotive Wash Facilities P C 5.2(F)(4) Bed & Breakfasts C C C C C 5.2(F)(5) Boarding House C 5.2(F)(6) Business Support Services P P P P P None Commercial Lodging C P P 5.2(F)(7) Communications/Broadcasting P P P P 5.2(F)(8) Convenience Retail C P P P 5.2(F)(9) Country Club C 5.2(F)(10) Day Care Centers C C P P C 5.2(F)(11) Entertainment/Recreation, Indoor Commercial P C C C 5.2(F)(12) Entertainment/Recreation, Outdoor Commercial C C C C 5.2(F)(13) Financial Institution P C P 5.2(F)(14) Funeral Services P P 5.2(F)(15) Kennels (commercial) C 5.2(F)(16) Landscaping / Nursery Business P 5.2(F)(17) Personal Services C P P P P P 5.2(F)(21) Recreational Vehicle Camp Site C C 5.2(F)(23) Repair Establishment C P P 5.2(F)(24) Restaurants C P P 5.2(F)(25) Retail Commercial Uses (other) P P P 5.2(F)(26) Specialty Eating Establishments C P P P 5.2(F)(27) Vehicle Fuel Sales C C C 5.2(F)(28) Vehicle Sales and Rental C C 5.2(F)(29) Veterinary Facilities (Rural) C 5.2(F)(30) Veterinary Facilities (Neighborhood) C C C 5.2(F)(30) Wholesale Sales P P P None CHAPTER 5: USE STANDARDS Section 5.1 Use Table Subsection (A) Explanation of Use Table Structure City of Monticello Zoning Ordinance Page 315 TABLE 5-1: USES BY DISTRICT (cont.) Use Types “P” = Permitted “C” = Conditionally Permitted “I” = Interim Permitted Base Zoning Districts Additional Requirements A O R A R 1 R 2 T N R 3 R 4 M H B 1 B 2 B 3 B 4 C C D I B C I 1 I 2 Industrial Uses Auto Repair – Major C *SE E T A B L E 5-1A P P 5.2(G)(1) Bulk Fuel Sales and Storage P P 5.2(G)(2) Extraction of Materials I I I 5.2(G)(3) General Warehousing C C P P 5.2(G)(4) Heavy Manufacturing C 5.2(G)(5) Industrial Services C P None Land Reclamation C C C C C C C C C C C C C C C 5.2(G)(6) Light Manufacturing C P P P 5.2(G)(7) Machinery/Truck Repair & Sales P P 5.2(G)(8) Recycling and Salvage Center C C 5.2(G)(9) Self-Storage Facilities P C P 5.2(G)(10) Truck or Freight Terminal C P P 5.2(G)(11) Waste Disposal & Incineration C 5.2(G)(12) Wrecker Services C P 5.2(G)(13) TABLE 5-1A: CENTRAL COMMUNITY DISTRICT (CCD) USES Use Types “P” = Permitted “C” = Conditionally Permitted “I” = Interim Permitted Sub-Districts Exceptions Additional Requirements F-1 F-2 F-3 L Commercial Day Care C C C C none 5.2(F)(11) Commercial Lodging P P C none 5.2(F)(7) Commercial Offices – Principal C P P C L-2: NA first floor, CUP upper floors 5.2(F)(19) Commercial Recreation: Indoor P P C C none 5.2(F)(12) Commercial Recreation: Outdoor C C none 5.2(F)(13) Convenience Retail C P* C C *F-2 Drive Through by CUP 5.2(F)(9) Funeral Services C C none 5.2(F)(15) CHAPTER 5: USE STANDARDS Section 5.1 Use Table Subsection (A) Explanation of Use Table Structure Page 316 City of Monticello Zoning Ordinance TABLE 5-1A: CENTRAL COMMUNITY DISTRICT (CCD) USES (cont.) Use Types “P” = Permitted “C” = Conditionally Permitted “I” = Interim Permitted Sub-Districts Exceptions Additional Requirements F-1 F-2 F-3 L Medical / Clinical Services C P P P L-2: NA first floor, CUP upper floors 5.2(F)(18) Personal Services P P P P L-2: NA first floor, CUP upper floors L-3: CUP 5.2(F)(21) Places of Public Assembly C C C C none 5.2(F)(22) Professional Office-Services Including Financial Institutions P P P C L-2: NA first floor, CUP upper floors 5.2(F)(14) 5.2(F)(20) Restaurants, Bars < 10,000 SF P P C C none 5.2(F)(25) Restaurants, Bars > 10,000 SF P C C none 5.2(F)(25) Retail Sales < 10,000 SF P P C C none 5.2(F)(26) Retail Sales > 10,000 SF P C C none 5.2(F)(26) Retail with Service P C C L-2: NA first floor, CUP upper floors 5.2(F)(26) Specialty Eating Establishments < 10,000 SF P* P* C* P* *Drive Through by CUP 5.2(F)(27) Vehicle Fuel Sales C C C 5.2(F)(28) Veterinary Facilities C P C C none 5.2(F)(30) Residential – Upper Floors P P P P L-2: NA Residential – Street Level C C L-2: NA Residential – Multiple Family C C L-2: NA Residential – Townhouse C none Residential – Single Family C none Industrial PUD L-3: PUD Only Public Buildings or Uses C C C P none CHAPTER 5: USE STANDARDS Section 5.2 Use-Specific Standards Subsection (D) Regulations for Civic and Institutional Uses City of Monticello Zoning Ordinance Page 329 (d) Adequate off-street parking and access is provided on the site or on lots directly abutting or directly across a public street or alley to the principal use in compliance with Section 4.8 of this ordinance and that such parking is adequately screened and landscaped from surrounding and abutting residential uses in compliance with Section 4.1(F) of this ordinance. (e) Adequate off-street loading and service entrances are considered and satisfactorily provided in accordance with Section 4.9 of this ordinance. (f) Exterior lighting standards outlined in Section 4.4 of this ordinance shall be met. (g) If locating within an industrial zoning district: (i) A specified termination date is documented. (ii) The proposed parcel has adequate improved parking to accommodate the student capacity. (iii) The proposed building is constructed or altered only in ways which do not interfere with future refitting for industrial use. (8) Places of Public Assembly (a) Institutions on parcels exceeding 20,000 square feet in area shall be located with direct frontage on, and access to, a collector or arterial street. (b) The buildings are set back from adjoining residential districts a distance no less than double the adjoining residential setback. (c) When abutting a residential use in a residential use district, the property shall be screened with an aesthetic buffer (Table 4-2, Buffer Type “B”) in accordance with section 4.1(G) of this ordinance. (d) Adequate off-street parking and access is provided on the site or on lots directly abutting or directly across a public street or alley to the principal use in compliance with Section 4.8 of this ordinance and that such parking is adequately screened and landscaped from surrounding and abutting residential uses in compliance with Section 4.1(F) of this ordinance. (e) Adequate off-street loading and service entrances are considered and satisfactorily provided. Section 4.1(F): Standards for Vehicular Use Area Landscaping Section 4.1(F): Standards for Vehicular Use Area Landscaping CHAPTER 8: RULES & DEFINITIONS Section 8.4 Definitions Subsection (B) Lots City of Monticello Zoning Ordinance Page 443 PHASING (in relation to grading): Clearing a parcel of land in distinct phases, with the stabilization of each phase completed before the clearing of the next. PLACE OF PUBLIC ASSEMBLY: An institution or facility that congregations of people regularly attend to participate in or hold meetings, workshops, lectures, civic activities, religious services, and other similar activities, including buildings in which such functions and activities are held. PLAN REQUIREMENTS AND DESIGN GUIDELINES: Manual detailing City specifications for all plan requirements. PLANNED UNIT DEVELOPMENT: A type of development which may incorporate a variety of land uses planned and developed as a unit. The planned unit development is distinguished from the traditional subdivision process of development in that zoning standards such as density, setbacks, height limits, and minimum lot sizes may be altered by negotiation and agreement between the developer, the municipality, and the Commissioner of Natural Resources as may be required. PLANTING STRIP: Areas intended for the placement of vegetation within the interior of vehicular use areas or along street right-of-way edges, typically between the back of the curb and the inside edge of the sidewalk. PORTABLE CONTAINER: A large container designed and rented or leased for the temporary storage of commercial, industrial, or residential household goods that does not contain a foundation or wheels for movement. PRINCIPAL USE: The main use of land or buildings as distinguished from subordinate or accessory uses. PUBLIC BUILDING OR USE: Any facility, including but not limited to buildings and property that are leased or otherwise operated or funded by a governmental body or public entity. PUBLIC WATERS: Any waters as defined in Minnesota Statutes, section 103G.005, Subd. 15, 15a. REACH (in relation to flood plains): A hydraulic engineering term to describe a longitudinal segment of a stream or river influenced by a natural or man -made obstruction. In an urban area, the segment of a stream or river between two consecutive bridge crossings would most typically constitute a reach.